GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-25 16:26:57, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_039123190             783 bp    mRNA    linear   PLN 27-JAN-2021
DEFINITION  PREDICTED: Phoenix dactylifera protein DEHYDRATION-INDUCED 19
            homolog 2-like (LOC120109426), mRNA.
ACCESSION   XM_039123190
VERSION     XM_039123190.1
DBLINK      BioProject: PRJNA692501
KEYWORDS    RefSeq; corrected model.
SOURCE      Phoenix dactylifera (date palm)
  ORGANISM  Phoenix dactylifera
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; Liliopsida; Arecaceae; Coryphoideae;
            Phoeniceae; Phoenix.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024069430.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Phoenix dactylifera Annotation
                                           Release 103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 2 indels
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-181               NBZB01001783.1     43797-43977         c
            182-304             NBZB01001783.1     43518-43640         c
            305-391             NBZB01001783.1     43429-43515         c
            392-450             NBZB01001783.1     43368-43426         c
            451-783             NBZB01001783.1     36413-36745         c
FEATURES             Location/Qualifiers
     source          1..783
                     /organism="Phoenix dactylifera"
                     /mol_type="mRNA"
                     /cultivar="Barhee BC4"
                     /db_xref="taxon:42345"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="young leaves"
                     /country="USA: California"
     gene            1..783
                     /gene="LOC120109426"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 4 bases in 2 codons;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 3 Proteins, and 85% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     95 samples with support for all annotated introns"
                     /db_xref="GeneID:120109426"
     CDS             92..553
                     /gene="LOC120109426"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 4 bases in 2 codons"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: protein DEHYDRATION-INDUCED
                     19 homolog 2-like"
                     /protein_id="XP_038979118.1"
                     /db_xref="GeneID:120109426"
                     /translation="
MQLQVCPICAARVGLDLVGHITTQHGSFFKMQYRRRFRRGSPGSHSMLSLLRKDLREGNLQSLLGGSSYMAPPSAAAPDPFCQSLIYTLPVAEAIKEMYNESLDEGSLVNKSLDEKVAERVEPSLSDEDQKERARRREFVQELVLSTIFDDTL"
     misc_feature    <104..169
                     /gene="LOC120109426"
                     /note="Drought induced 19 protein (Di19), zinc-binding;
                     Region: zf-Di19; pfam05605"
                     /db_xref="CDD:428539"
     misc_feature    233..535
                     /gene="LOC120109426"
                     /note="Stress-induced protein Di19, C-terminal; Region:
                     Di19_C; pfam14571"
                     /db_xref="CDD:434045"
ORIGIN      
ttacctagcatataataccaaaattttatgattcatgtcatgtaatttttatgttgaaaaatactattaatgcttagagttgggatgaattatgcaattgcaggtatgtcccatttgtgcagctagggttggtttggacttggttgggcacataacaacacagcatggaagtttcttcaagatgcaatatagaaggagattccgcagaggttcacctgggtcccattcaatgctatctttgttgagaaaggatctaagggaaggcaatctacaatctcttcttggaggatcttcctacatggctccgccttctgctgcggcacctgatcctttctgtcaatcattgatttacactttacctgtggctgaggcaatcaaagagatgtacaacgagtctttggatgaaggaagtctggttaacaagagtttagatgaaaaggttgcagagagggtggaaccatctctatctgacgaggaccagaaggagagagctcgaaggagggaatttgtacaggagcttgtgctctctacaatatttgatgacacattatgaaggagttctctaccactatggtggctaaaggggccgttgagaaaacgccaggatcatcagcaagctgcgtcattgttgtaattgttgctcatcatctcctttggatcagtgggagcatttatttgatggttgtatatttataactgccttaagagagggaggagcatggattgtatttatacatttaacattagtatcaatatctgaagcgactatttctacaacaacaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]