GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 14:23:43, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       XM_039099581            1520 bp    mRNA    linear   ROD 21-JAN-2021
DEFINITION  PREDICTED: Rattus norvegicus claudin 2 (Cldn2), transcript variant
            X2, mRNA.
ACCESSION   XM_039099581
VERSION     XM_039099581.1
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051356.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Rattus norvegicus Annotation Release
                                           108
            Annotation Version          :: 108
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1520
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..1520
                     /gene="Cldn2"
                     /gene_synonym="RGD1560247"
                     /note="claudin 2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 13 ESTs, and 96% coverage
                     of the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:300920"
                     /db_xref="RGD:1560247"
     CDS             407..1093
                     /gene="Cldn2"
                     /gene_synonym="RGD1560247"
                     /codon_start=1
                     /product="claudin-2 isoform X2"
                     /protein_id="XP_038955509.1"
                     /db_xref="GeneID:300920"
                     /db_xref="RGD:1560247"
                     /translation="
MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQESRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTG"
     misc_feature    419..949
                     /gene="Cldn2"
                     /gene_synonym="RGD1560247"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:419754"
ORIGIN      
cctcaatcttttccagcctccaggggtttaattcgcatctgtaagaaggctcagatttacaggtggattttacaaagctgtggctaataattagaaatcccttatcaccacagcccgtggccccttggacccagttcacctttccctggacctagtcctcttttccgctggagcatctctcccagagcccttcgagaaagaacagctccgtgagtatctgctctgttttctagatgccttcttgagcctgcttgtggccacccacagatacttgtaaggaggaaagaagtcagcttgccagagacactgtgaaatgagggattagaggccgggatccaagaaacaagagccgcagccaaaagacaagcgaacaggttccgaagatacttctactgagaggtctgccatggcctcccttggcgtccaactggtgggctacatcctaggccttttggggctattaggcacatcgattgccatgctgctccccaactggcgaacaagttcttatgttggtgccagcattgtgacggcggttggcttttccaagggcctctggatggagtgtgcgacccacagcactggcatcacccagtgtgatatctacagtactcttttaggacttcctgctgacatccaggctgcccaggccatgatggtgacatccagtgcaatgtcctcgctggcctgcattatctctgtggtgggcatgagatgcacagtgttctgccaggaatctcgagctaaggacagagtggctgtagtgggtggagtctttttcatccttggtggtatcctgggttttatcccagttgcttggaatcttcacggcattctccgggacttctactcaccactggtccctgacagcatgaaatttgagattggagaagctctgtacttgggaatcatttcagcgctgttttccttggtagctggagtcatcctctgcttttcctgctcacctcagggaaatcgtaccaactactatgatggctaccaggcccagcctcttgccactaggagctctccaagatctgctcaacagcccaaagccaagagtgagttcaactcatacagcctgactggctgaccacgcttctgggaaccgtaactctcagtcagagttttctgtcccaagagtccatgctctagagaagacaagcagcacttgataaagcaccatacaaaggtacatctcggcccttgggaggagttgctgctttcttgtcatccctgaagtcctgtctctttggaatgaccctctcaccacatcacgagtcacctagaaggtctttgaagaactttgcaagcactcatgatcttgtagagagataacccagggaatactcgtatacttttccagcataggtgacaagatggcacactaagtggcaagtgagtgatgtgtcaggcacagcctctttacacaattatcactctgaaatagttttaaaaagttcagtggggattgctggaggcaaagggcagtgctctaaaagttaaaaaacaaaacaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]