2025-07-11 09:19:12, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_039022647 686 bp mRNA linear PLN 13-JAN-2021 DEFINITION PREDICTED: Benincasa hispida signal peptidase complex subunit 3B-like (LOC120070765), mRNA. ACCESSION XM_039022647 VERSION XM_039022647.1 DBLINK BioProject: PRJNA691418 KEYWORDS RefSeq. SOURCE Benincasa hispida (wax gourd) ORGANISM Benincasa hispida Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Benincasa. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052350.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Benincasa hispida Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..686 /organism="Benincasa hispida" /mol_type="mRNA" /cultivar="B227" /db_xref="taxon:102211" /chromosome="2" /tissue_type="young leaf" /dev_stage="seedlings with two fully expanded leaves" /geo_loc_name="China: Guangdong" gene 1..686 /gene="LOC120070765" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 55 samples with support for all annotated introns" /db_xref="GeneID:120070765" CDS 1..504 /gene="LOC120070765" /codon_start=1 /product="signal peptidase complex subunit 3B-like" /protein_id="XP_038878575.1" /db_xref="GeneID:120070765" /translation="
MHSFGYRANALVTFAVTILVIMCAMASFSDNFNSPSPTASVQVLNINWFQKQLHGNDEVSMTLNISVDLQSLFTWNTKQVFVFVAAEYETPKNSLNQISLWDGIIPSKDNAKFTIHTSNKYRFIDQGSNLRGKEFNLTLHWHVMPKTGKMFADKIVMSGYRLPEDYR"
misc_feature 1..492 /gene="LOC120070765" /note="Signal peptidase subunit; Region: SPC22; pfam04573" /db_xref="CDD:461357" ORIGIN
atgcattcttttggttatcgagccaatgctttggtcactttcgccgtcaccattctcgtaattatgtgcgccatggcctctttctccgataacttcaactctccctctcccaccgccagtgttcaggtgttgaacatcaactggtttcagaagcagcttcatggaaatgacgaggtcagcatgaccttaaatatctcggtggacttgcagtcactatttacatggaacacaaagcaggtttttgtttttgtagctgctgagtatgaaactcctaagaattccttgaaccagatctcgctttgggatggtataataccttccaaagataatgccaaatttacgattcacacttcaaacaagtaccgtttcatcgatcagggaagcaatctcagaggtaaagaattcaacttgacgctgcattggcatgtaatgccaaaaaccggtaaaatgttcgctgataagatagtgatgtctgggtatcgcttaccggaggactatcgatgaagatgccttgatatggtatttaaaaacttacttttccatatatgagaatacagaaaattcagttcagctgagttagaaatttacagacaggagaaaagttgcatgtatgaaacaaatagaaagtgagttttgcttggagtttttgattcattcttctctcatttgcattttctctctcccta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]