GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:23:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_038983386             377 bp    mRNA    linear   VRT 13-JAN-2021
DEFINITION  PREDICTED: Salvelinus namaycush plasma membrane
            calcium-transporting ATPase 2-like (LOC120037211), mRNA.
ACCESSION   XM_038983386
VERSION     XM_038983386.1
DBLINK      BioProject: PRJNA690826
KEYWORDS    RefSeq.
SOURCE      Salvelinus namaycush (lake trout)
  ORGANISM  Salvelinus namaycush
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salvelinus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024058374.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Salvelinus namaycush Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..377
                     /organism="Salvelinus namaycush"
                     /mol_type="mRNA"
                     /isolate="Seneca"
                     /db_xref="taxon:8040"
                     /chromosome="Unknown"
                     /sex="female"
                     /tissue_type="white muscle"
     gene            1..377
                     /gene="LOC120037211"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 15 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:120037211"
     CDS             3..287
                     /gene="LOC120037211"
                     /codon_start=1
                     /product="plasma membrane calcium-transporting ATPase
                     2-like"
                     /protein_id="XP_038839314.1"
                     /db_xref="GeneID:120037211"
                     /translation="
MKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQTFLGDQHHRSVPEPEQVNPKTLELLVNAIAINSAYTSKIMVQRGTGGGREEIGTD"
     misc_feature    <3..>281
                     /gene="LOC120037211"
                     /note="plasma-membrane calcium-translocating P-type
                     ATPase; Region: ATPase-IIB_Ca; TIGR01517"
                     /db_xref="CDD:273668"
     misc_feature    <3..>131
                     /gene="LOC120037211"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      
tgatgaaggataataacctggtgcgtcacctggatgcgtgtgagacgatggggaacgccacggccatctgctccgacaagaccggcactctgaccaccaaccgcatgactgtcgtacagaccttcctaggtgaccagcaccaccggtcagttccggaaccagaacaggtcaaccccaagactctggaactactggtcaacgccatcgctatcaacagtgcctacacgtccaagatcatggtgcagagagggacggggggtggacgggaggagatagggacagactgacaccaacactgagactgagagacggagaaaaagacaacagacacacaaacactgagactgagagacggcgacagagaaaaagaaaagaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]