2024-05-20 10:23:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_038983386 377 bp mRNA linear VRT 13-JAN-2021 DEFINITION PREDICTED: Salvelinus namaycush plasma membrane calcium-transporting ATPase 2-like (LOC120037211), mRNA. ACCESSION XM_038983386 VERSION XM_038983386.1 DBLINK BioProject: PRJNA690826 KEYWORDS RefSeq. SOURCE Salvelinus namaycush (lake trout) ORGANISM Salvelinus namaycush Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salvelinus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024058374.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Salvelinus namaycush Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..377 /organism="Salvelinus namaycush" /mol_type="mRNA" /isolate="Seneca" /db_xref="taxon:8040" /chromosome="Unknown" /sex="female" /tissue_type="white muscle" gene 1..377 /gene="LOC120037211" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns" /db_xref="GeneID:120037211" CDS 3..287 /gene="LOC120037211" /codon_start=1 /product="plasma membrane calcium-transporting ATPase 2-like" /protein_id="XP_038839314.1" /db_xref="GeneID:120037211" /translation="
MKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQTFLGDQHHRSVPEPEQVNPKTLELLVNAIAINSAYTSKIMVQRGTGGGREEIGTD"
misc_feature <3..>281 /gene="LOC120037211" /note="plasma-membrane calcium-translocating P-type ATPase; Region: ATPase-IIB_Ca; TIGR01517" /db_xref="CDD:273668" misc_feature <3..>131 /gene="LOC120037211" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
tgatgaaggataataacctggtgcgtcacctggatgcgtgtgagacgatggggaacgccacggccatctgctccgacaagaccggcactctgaccaccaaccgcatgactgtcgtacagaccttcctaggtgaccagcaccaccggtcagttccggaaccagaacaggtcaaccccaagactctggaactactggtcaacgccatcgctatcaacagtgcctacacgtccaagatcatggtgcagagagggacggggggtggacgggaggagatagggacagactgacaccaacactgagactgagagacggagaaaaagacaacagacacacaaacactgagactgagagacggcgacagagaaaaagaaaagaga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]