GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-20 02:01:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_038955307             678 bp    mRNA    linear   PLN 12-FEB-2021
DEFINITION  Botrytis deweyae uncharacterized protein (EAE98_007684), partial
            mRNA.
ACCESSION   XM_038955307
VERSION     XM_038955307.1
DBLINK      BioProject: PRJNA691331
            BioSample: SAMN10219761
KEYWORDS    RefSeq.
SOURCE      Botrytis deweyae
  ORGANISM  Botrytis deweyae
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Leotiomycetes; Helotiales; Sclerotiniaceae; Botrytis.
REFERENCE   1  (bases 1 to 678)
  AUTHORS   Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L.
  TITLE     Comparative genomics of Sclerotiniaceae
  JOURNAL   Genome Biol Evol (2020) In press
REFERENCE   2  (bases 1 to 678)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 678)
  AUTHORS   Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-OCT-2018) Laboratory of Phytopathology, Wageningen
            University & Research, Droevendaalsesteeg 1, Wageningen 6708 PB,
            Netherlands
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024066225).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..678
                     /organism="Botrytis deweyae"
                     /mol_type="mRNA"
                     /strain="B1"
                     /host="Hemerocallis"
                     /db_xref="taxon:2478750"
                     /chromosome="Unknown"
                     /country="United Kingdom: Oxford"
                     /collection_date="2009-11-30"
     gene            <1..>678
                     /locus_tag="EAE98_007684"
                     /db_xref="GeneID:62234457"
     CDS             1..678
                     /locus_tag="EAE98_007684"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038808485.1"
                     /db_xref="GeneID:62234457"
                     /translation="
MAFHPAQTWYPSFHDIQPNPNLPFSNNTPPIIDIPLNSREIQYREICGMLKYTQDNTRQVTRDEKKYARALRVALVRLRVGGGEGRDGRERMRKVVVLRKVVRSHQEYRKNLRVCEGVLWRKEYELKRMLRLRVGGIGNADYYEGRNWWFVAGEEESDDEDEDEDEDGEGEDDEDEVDEVDEVDEEDDEDGEEGIDEGDEVEGTEGMELECWSEEDEDLEMEMEG"
ORIGIN      
atggcattccaccccgcccaaacctggtacccatcattccacgacatccagccaaatcccaacttacctttcagcaataatactcccccaatcatcgatatccctttgaattcccgagaaatacagtatagagagatttgcggtatgttaaaatatacccaagacaacacgagacaagttacgagagacgagaagaaatacgcacgagcacttcgtgttgcattggtgagattgcgtgtgggagggggagagggaagagatgggagggaaagaatgaggaaagtggttgtgttgcggaaagtagtgcggtcgcatcaggagtataggaagaatttgagagtgtgtgagggtgtgttgtggaggaaggaatatgagttgaagaggatgttgagattgcgggtgggggggattgggaatgcggattattatgaggggagaaattggtggtttgtggcgggggaagaggaaagtgatgatgaggatgaggatgaggatgaggatggcgagggtgaagatgatgaggatgaggtggatgaggtagatgaggtagatgaggaagatgacgaggatggggaagagggaatagatgagggagatgaagttgaaggaacggagggaatggaattagagtgctggagtgaggaagatgaggatttggaaatggagatggaaggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]