GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 06:56:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_038905316             672 bp    mRNA    linear   PLN 12-FEB-2021
DEFINITION  Botrytis sinoallii uncharacterized protein (EAF02_009268), partial
            mRNA.
ACCESSION   XM_038905316
VERSION     XM_038905316.1
DBLINK      BioProject: PRJNA691331
            BioSample: SAMN10219765
KEYWORDS    RefSeq.
SOURCE      Botrytis sinoallii
  ORGANISM  Botrytis sinoallii
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Leotiomycetes; Helotiales; Sclerotiniaceae; Botrytis.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L.
  TITLE     Comparative genomics of Sclerotiniaceae
  JOURNAL   Genome Biol Evol (2020) In press
REFERENCE   2  (bases 1 to 672)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 672)
  AUTHORS   Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2018) Laboratory of Phytopathology, Wageningen
            University & Research, Droevendaalsesteeg 1, Wageningen 6708 PB,
            Netherlands
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024066046).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Botrytis sinoallii"
                     /mol_type="mRNA"
                     /strain="Bc 23"
                     /host="Allium"
                     /type_material="culture from holotype of Botrytis
                     sinoallii"
                     /db_xref="taxon:1463999"
                     /chromosome="Unknown"
                     /country="China: Xianning City, Hubei Province"
                     /collection_date="2006-05-02"
     gene            <1..>672
                     /locus_tag="EAF02_009268"
                     /db_xref="GeneID:62178391"
     CDS             1..672
                     /locus_tag="EAF02_009268"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038754769.1"
                     /db_xref="GeneID:62178391"
                     /translation="
MSFHPTQTWYPSFHDIQPNPNSPFSNATPSILDIPLNSQETQYREICGMLKYTQDNTRQVTKDEKKHARALRVALVRLRVGGGEGRDGRERMRKAVVLRKVVRSHQEYKKNLLVCEGVLWRKEHELKRMLRLRVRENGNADYYEGRNWWFVAGEEESDDEDEDENGEGEDDEDEVDEVDEVDEEDDEDGEEGIDEGDEVEGTEGMELECWSEEDEDLEMEMEG"
ORIGIN      
atgtcattccaccccacccaaacctggtacccatcattccacgacatccagccaaatcccaactcacctttcagcaatgctactccctcaatcctcgatatccctttgaattcccaagaaacacagtatagagagatttgcggtatgttaaaatatacccaagacaacacgagacaagttacgaaagacgagaagaaacacgcacgagcacttcgtgtcgcattggtgagattgcgtgtgggagggggggagggaagagatgggagggaaagaatgaggaaagcggttgtgttgcggaaagtagtgcggtcgcatcaggagtataagaagaatttgttggtgtgtgaaggtgtgttgtggaggaaggaacatgagttgaagaggatgttgagattgcgggtgagggagaatgggaatgcggattattatgaggggagaaattggtggtttgtggcgggggaagaggaaagtgatgatgaggatgaggatgagaatggcgagggtgaagatgatgaggatgaggtggatgaggtagatgaggtagatgaggaagatgacgaggatggggaagagggaatagatgagggagatgaagttgaaggaacggagggaatggaattagagtgctggagtgaggaagatgaggatttggaaatggagatggaaggatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]