2024-04-26 06:56:23, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_038905316 672 bp mRNA linear PLN 12-FEB-2021 DEFINITION Botrytis sinoallii uncharacterized protein (EAF02_009268), partial mRNA. ACCESSION XM_038905316 VERSION XM_038905316.1 DBLINK BioProject: PRJNA691331 BioSample: SAMN10219765 KEYWORDS RefSeq. SOURCE Botrytis sinoallii ORGANISM Botrytis sinoallii Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Leotiomycetes; Helotiales; Sclerotiniaceae; Botrytis. REFERENCE 1 (bases 1 to 672) AUTHORS Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L. TITLE Comparative genomics of Sclerotiniaceae JOURNAL Genome Biol Evol (2020) In press REFERENCE 2 (bases 1 to 672) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (12-FEB-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 672) AUTHORS Valero Jimenez,C.A., Steentjes,M., Scholten,O.E. and Van Kan,J.A.L. TITLE Direct Submission JOURNAL Submitted (16-OCT-2018) Laboratory of Phytopathology, Wageningen University & Research, Droevendaalsesteeg 1, Wageningen 6708 PB, Netherlands COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_024066046). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..672 /organism="Botrytis sinoallii" /mol_type="mRNA" /strain="Bc 23" /host="Allium" /type_material="culture from holotype of Botrytis sinoallii" /db_xref="taxon:1463999" /chromosome="Unknown" /country="China: Xianning City, Hubei Province" /collection_date="2006-05-02" gene <1..>672 /locus_tag="EAF02_009268" /db_xref="GeneID:62178391" CDS 1..672 /locus_tag="EAF02_009268" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_038754769.1" /db_xref="GeneID:62178391" /translation="
MSFHPTQTWYPSFHDIQPNPNSPFSNATPSILDIPLNSQETQYREICGMLKYTQDNTRQVTKDEKKHARALRVALVRLRVGGGEGRDGRERMRKAVVLRKVVRSHQEYKKNLLVCEGVLWRKEHELKRMLRLRVRENGNADYYEGRNWWFVAGEEESDDEDEDENGEGEDDEDEVDEVDEVDEEDDEDGEEGIDEGDEVEGTEGMELECWSEEDEDLEMEMEG"
ORIGIN
atgtcattccaccccacccaaacctggtacccatcattccacgacatccagccaaatcccaactcacctttcagcaatgctactccctcaatcctcgatatccctttgaattcccaagaaacacagtatagagagatttgcggtatgttaaaatatacccaagacaacacgagacaagttacgaaagacgagaagaaacacgcacgagcacttcgtgtcgcattggtgagattgcgtgtgggagggggggagggaagagatgggagggaaagaatgaggaaagcggttgtgttgcggaaagtagtgcggtcgcatcaggagtataagaagaatttgttggtgtgtgaaggtgtgttgtggaggaaggaacatgagttgaagaggatgttgagattgcgggtgagggagaatgggaatgcggattattatgaggggagaaattggtggtttgtggcgggggaagaggaaagtgatgatgaggatgaggatgagaatggcgagggtgaagatgatgaggatgaggtggatgaggtagatgaggtagatgaggaagatgacgaggatggggaagagggaatagatgagggagatgaagttgaaggaacggagggaatggaattagagtgctggagtgaggaagatgaggatttggaaatggagatggaaggatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]