GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 05:29:44, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_038892488             381 bp    mRNA    linear   PLN 12-FEB-2021
DEFINITION  Colletotrichum karsti uncharacterized protein (CkaCkLH20_09773),
            partial mRNA.
ACCESSION   XM_038892488
VERSION     XM_038892488.1
DBLINK      BioProject: PRJNA691333
            BioSample: SAMN14421089
KEYWORDS    RefSeq.
SOURCE      Colletotrichum karsti
  ORGANISM  Colletotrichum karsti
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae;
            Colletotrichum; Colletotrichum boninense species complex.
REFERENCE   1  (bases 1 to 381)
  AUTHORS   Li,H.
  TITLE     Whole genome sequencing of Colletotrichum sp.
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 381)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 381)
  AUTHORS   Li,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-NOV-2020) College of Forestry, Central South
            University of Forestry and Technology, Shaoshan South Road, No.
            498, Changsha, Hunan 410004, China
REFERENCE   4  (bases 1 to 381)
  AUTHORS   He,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-MAR-2020) College of Forestry, Central South
            University of Forestry and Technology, Shaoshan South Road, No.
            498, Changsha, Hunan 410004, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024065935).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..381
                     /organism="Colletotrichum karsti"
                     /mol_type="mRNA"
                     /strain="CkLH20"
                     /isolation_source="leaves"
                     /host="Camellia oleifera"
                     /db_xref="taxon:1095194"
                     /chromosome="Unknown"
                     /country="China: Huna"
                     /collection_date="2017-02-12"
     gene            <1..>381
                     /locus_tag="CkaCkLH20_09773"
                     /db_xref="GeneID:62165562"
     CDS             1..381
                     /locus_tag="CkaCkLH20_09773"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_038742371.1"
                     /db_xref="GeneID:62165562"
                     /translation="
MAPGIIERIQQKIELFRLEQRYTRRRHRRSTFMSNAVYVDGEYVYQTPNSTGSSSTGSTSSKETSSGVNALHHAEPLSPTVAPAQTEPSKKRLSRFASMPGFGSSSKQSPTQDWRTSNVTVDEVRR"
ORIGIN      
atggcccccggtatcattgagcgcatccaacaaaagattgagctcttccgtctggagcagcgctacacccgccgtcgccatcgccgatctacctttatgtccaacgccgtctacgtcgatggcgagtacgtctaccagacccccaattccaccggttcctcctcgaccggtagcaccagcagcaaggagacatcctccggcgtcaacgcccttcaccacgcagagccactttctcctaccgtggcccccgcgcagactgagcccagcaagaagagattgagccgtttcgcctccatgcccggctttggatcatcaagcaagcagagcccgactcaggactggcggacaagtaatgtcactgtcgacgaggtccgacggtag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]