LOCUS       XM_038842755             351 bp    mRNA    linear   PLN 09-JAN-2021
DEFINITION  PREDICTED: Tripterygium wilfordii uncharacterized LOC119996202
            (LOC119996202), mRNA.
ACCESSION   XM_038842755
VERSION     XM_038842755.1
DBLINK      BioProject: PRJNA689611
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Tripterygium wilfordii
  ORGANISM  Tripterygium wilfordii
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Celastrales; Celastraceae;
            Tripterygium.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_052232.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Tripterygium wilfordii Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..351
                     /organism="Tripterygium wilfordii"
                     /mol_type="mRNA"
                     /isolate="XIE 37"
                     /db_xref="taxon:458696"
                     /chromosome="1"
                     /tissue_type="leaf"
                     /dev_stage="mature plant"
                     /geo_loc_name="China: Taining County, Fujian Province"
     gene            1..351
                     /gene="LOC119996202"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:119996202"
     CDS             1..351
                     /gene="LOC119996202"
                     /codon_start=1
                     /product="uncharacterized protein LOC119996202"
                     /protein_id="XP_038698683.1"
                     /db_xref="GeneID:119996202"
                     /translation="

MQRVRKREDDGEWIQEEAKVALEKLWVEPDYVKKRDKAMMNRASETGGCTNTGGSIPHSEHKKRLNDYNKLKEACSSQASTSGESPLEPQDDDSIFMEVTKWVNKKGRVYGLGSKA"

     misc_feature    61..342
                     /gene="LOC119996202"
                     /note="Plant transposase (Ptta/En/Spm family); Region:
                     Transposase_24; pfam03004"
                     /db_xref="CDD:367291"
ORIGIN      

atgcaaagggttcgaaaaagggaggatgatggtgaatggattcaagaggaagccaaagttgcgcttgaaaagctttgggtggaaccggattatgtgaagaaaagggataaggcaatgatgaaccgagcatccgagactggcgggtgcactaatactggtggctctattccacactcggaacacaagaagagattgaatgattacaacaagctgaaggaagcctgttctagtcaagcatcgacctctggagagtcacctcttgaaccgcaggatgatgattccatattcatggaggtgactaagtgggtcaataagaaaggtcgtgtctacggtcttggatcaaaggcgtga

//