2025-09-18 22:44:40, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_038842755 351 bp mRNA linear PLN 09-JAN-2021 DEFINITION PREDICTED: Tripterygium wilfordii uncharacterized LOC119996202 (LOC119996202), mRNA. ACCESSION XM_038842755 VERSION XM_038842755.1 DBLINK BioProject: PRJNA689611 KEYWORDS RefSeq; includes ab initio. SOURCE Tripterygium wilfordii ORGANISM Tripterygium wilfordii Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Celastrales; Celastraceae; Tripterygium. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_052232.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Tripterygium wilfordii Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..351 /organism="Tripterygium wilfordii" /mol_type="mRNA" /isolate="XIE 37" /db_xref="taxon:458696" /chromosome="1" /tissue_type="leaf" /dev_stage="mature plant" /geo_loc_name="China: Taining County, Fujian Province" gene 1..351 /gene="LOC119996202" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:119996202" CDS 1..351 /gene="LOC119996202" /codon_start=1 /product="uncharacterized protein LOC119996202" /protein_id="XP_038698683.1" /db_xref="GeneID:119996202" /translation="
MQRVRKREDDGEWIQEEAKVALEKLWVEPDYVKKRDKAMMNRASETGGCTNTGGSIPHSEHKKRLNDYNKLKEACSSQASTSGESPLEPQDDDSIFMEVTKWVNKKGRVYGLGSKA"
misc_feature 61..342 /gene="LOC119996202" /note="Plant transposase (Ptta/En/Spm family); Region: Transposase_24; pfam03004" /db_xref="CDD:367291" ORIGIN
atgcaaagggttcgaaaaagggaggatgatggtgaatggattcaagaggaagccaaagttgcgcttgaaaagctttgggtggaaccggattatgtgaagaaaagggataaggcaatgatgaaccgagcatccgagactggcgggtgcactaatactggtggctctattccacactcggaacacaagaagagattgaatgattacaacaagctgaaggaagcctgttctagtcaagcatcgacctctggagagtcacctcttgaaccgcaggatgatgattccatattcatggaggtgactaagtgggtcaataagaaaggtcgtgtctacggtcttggatcaaaggcgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]