GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 05:14:36, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_036812515             333 bp    mRNA    linear   PLN 28-OCT-2020
DEFINITION  Candida parapsilosis uncharacterized protein (CPAR2_104710),
            partial mRNA.
ACCESSION   XM_036812515
VERSION     XM_036812515.1
DBLINK      BioProject: PRJNA12179
KEYWORDS    RefSeq.
SOURCE      Candida parapsilosis
  ORGANISM  Candida parapsilosis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Candida.
REFERENCE   1  (bases 1 to 333)
  AUTHORS   Guida,A., Lindstaedt,C., Maguire,S.L., Ding,C., Higgins,D.G.,
            Harris,D., Berriman,M. and Butler,G.
  TITLE     Transcriptional landscape of the pathogenic yeast Candida
            parapsilosis
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 333)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 333)
  AUTHORS   Guida,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2011) to the INSDC
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_023503278).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..333
                     /organism="Candida parapsilosis"
                     /mol_type="mRNA"
                     /strain="CDC317"
                     /db_xref="taxon:5480"
                     /chromosome="Unknown"
     gene            <1..>333
                     /locus_tag="CPAR2_104710"
                     /db_xref="GeneID:59382184"
     CDS             1..333
                     /locus_tag="CPAR2_104710"
                     /note="Similar to C. albicans ATP14, Putative
                     mitochondrial F1F0 ATP synthase subunit"
                     /codon_start=1
                     /transl_table=12
                     /product="uncharacterized protein"
                     /protein_id="XP_036663615.1"
                     /db_xref="GeneID:59382184"
                     /translation="
MFRPIARISSRRLFSITPRRSNLIGDLYVQNIRQFKPQALSQEEIDSAVKKFQLPGKPTIPQIHELSTEQVKEYEQNEVEAEAAQPTEANSETKPDEDWFVFDEVEAEGH"
     misc_feature    43..237
                     /locus_tag="CPAR2_104710"
                     /note="ATP synthase complex subunit h; Region: ATP_sub_h;
                     pfam10775"
                     /db_xref="CDD:402416"
ORIGIN      
atgttcagaccaattgcccgtatatcatcaagaagattgttttcaatcactcctagaagatcaaacttgattggagacttgtatgtccaaaacattagacaattcaaaccacaagccctttcacaagaagagattgattccgcagttaagaagtttcaattaccaggtaaaccaaccattccacaaattcacgaattgtcaactgaacaagttaaagagtatgagcaaaatgaagttgaagctgaggctgcacaaccaactgaagctaattctgaaactaaaccagatgaagattggtttgtttttgatgaagttgaagctgaaggacattag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]