2025-10-19 04:49:28, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_036676707 333 bp mRNA linear PLN 29-DEC-2023 DEFINITION Fusarium subglutinans uncharacterized protein (FSUBG_11968), partial mRNA. ACCESSION XM_036676707 VERSION XM_036676707.1 DBLINK BioProject: PRJNA670753 BioSample: SAMN13683616 KEYWORDS RefSeq. SOURCE Fusarium subglutinans ORGANISM Fusarium subglutinans Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Hypocreomycetidae; Hypocreales; Nectriaceae; Fusarium; Fusarium fujikuroi species complex. REFERENCE 1 (bases 1 to 333) AUTHORS Kim,H.S., Lohmar,J.M., Busman,M., Brown,D.W., Naumann,T.A., Divon,H.H., Lysoe,E., Uhlig,S. and Proctor,R.H. TITLE Correction to: Identification and distribution of gene clusters required for synthesis of sphingolipid metabolism inhibitors in diverse species of the filamentous fungus Fusarium JOURNAL BMC Genomics 21 (1), 712 (2020) PUBMED 33059601 REMARK Correction to:[BMC Genomics. 2020 Jul 23;21(1):510. PMID: 32703172] Publication Status: Online-Only REFERENCE 2 (bases 1 to 333) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 333) AUTHORS Kim,H.-S., Proctor,R.H. and Brown,D.W. TITLE Direct Submission JOURNAL Submitted (01-MAY-2020) Mycotoxin Prevention and Applied Microbiology Research Unit, USDA, ARS, NCAUR, 1815 N University St, Peoria, IL 61604, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_023502305). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..333 /organism="Fusarium subglutinans" /mol_type="mRNA" /strain="NRRL 66333" /isolation_source="Plant" /host="Zea mays" /culture_collection="NRRL:66333" /db_xref="taxon:42677" /chromosome="Unknown" /geo_loc_name="USA: New Mexico" gene <1..>333 /locus_tag="FSUBG_11968" /db_xref="GeneID:59311425" CDS 1..333 /locus_tag="FSUBG_11968" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_036532576.1" /db_xref="GeneID:59311425" /translation="
MFHLNASAVRSGMAMFILSMDGMFWAPMVVLTLGIPYYVASGGPIPTPGKEAKVPGVEGTYAAIIDNPESPMEVYKMMPRGKLSIIVAVPPNGSEVSMTSTEIPWSVFKA"
ORIGIN
atgtttcacctcaacgcttccgccgtgagatccgggatggccatgttcatcttgtcaatggacgggatgttctgggccccgatggtggttctaactcttggaataccctattacgtggcaagcggcggcccaataccaacgccagggaaggaagccaaagtgcctggtgtcgaaggaacctacgccgctatcatcgacaatccggagagccccatggaagtctacaagatgatgccgcgcggtaaacttagtatcatcgttgctgtgcccccgaacgggtcagaggtcagcatgacctctaccgaaatcccatggtctgtcttcaaggcgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]