2024-05-19 16:47:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_036201456 921 bp mRNA linear ROD 23-SEP-2020 DEFINITION PREDICTED: Onychomys torridus copper chaperone for superoxide dismutase (Ccs), transcript variant X2, mRNA. ACCESSION XM_036201456 VERSION XM_036201456.1 DBLINK BioProject: PRJNA664182 KEYWORDS RefSeq. SOURCE Onychomys torridus (southern grasshopper mouse) ORGANISM Onychomys torridus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Cricetidae; Neotominae; Onychomys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_050443.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Onychomys torridus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..921 /organism="Onychomys torridus" /mol_type="mRNA" /db_xref="taxon:38674" /chromosome="1" gene 1..921 /gene="Ccs" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:118592453" CDS 120..809 /gene="Ccs" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_036057349.1" /db_xref="GeneID:118592453" /translation="
MASDSGDGGTMCALEFAVQMTCQSCVDSVRRTLQGVTENLGAAVAILEGQNAIQGVVRFLQLTSELCLIEGTVDGLPPGLHGFHVHQYGDLTRDCNSCGDHFNPDGTSHGGPQDTDRHRGDLGNILAEADGRSTFRIEDKQLKVWDVIGRSLVIDEGEDDLGRGNHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGEGRKDSSAQPPAHL"
misc_feature 162..>281 /gene="Ccs" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(177..185,192..194) /gene="Ccs" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature order(249..251,255..257,285..287,291..293,381..389, 561..566) /gene="Ccs" /note="E-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature 276..671 /gene="Ccs" /note="Copper/zinc superoxide dismutase (SODC); Region: Sod_Cu; pfam00080" /db_xref="CDD:425456" misc_feature order(321..323,495..497) /gene="Ccs" /note="P-class dimer interface [polypeptide binding]; other site" /db_xref="CDD:238186" misc_feature order(369..371,375..377,420..422,471..473,480..482, 582..584) /gene="Ccs" /note="active site" /db_xref="CDD:238186" misc_feature order(369..371,375..377,420..422,582..584) /gene="Ccs" /note="Cu2+ binding site [ion binding]; other site" /db_xref="CDD:238186" misc_feature order(420..422,444..446,471..473,480..482) /gene="Ccs" /note="Zn2+ binding site [ion binding]; other site" /db_xref="CDD:238186" ORIGIN
cgcgccaaggaggtggagcgaagggtggctcctgaggctccgcccaccccacaagactgagtggtgttggtctctggaccctagttgttttgctgctcaggcagttgactacatcccagatggcttcggattccggggacggtgggacaatgtgcgcgctggagtttgcagtgcagatgacctgtcagagctgtgtggactcggtgcgcaggaccctgcaaggggtgacagagaacctaggagcagcagtagccattctggagggccagaacgccatacagggtgtggtccgcttcctacagctgacctctgagctctgcctgattgagggaaccgttgatggcctgccgcctgggctgcatgggttccatgtccatcagtatggggatctcacaagggattgcaatagctgtggggaccattttaaccctgatggaacatctcatgggggccctcaggacactgatcggcaccggggagatctgggcaacatcctggctgaggctgacggccgatccaccttccggatagaggataaacagctgaaggtgtgggatgtgattggccgcagcctggttattgatgagggagaagatgacctgggccggggaaaccatccgttatccaagatcacaggcaactctggcaagaggttggcctgtggcatcatagcacgctctgctggcctcttccagaatcccaagcagatctgttcctgtgatggcctcactatctgggaggagcgaggcaggcccattgctggtgaaggccgaaaagactcctcagcccagccccctgctcacctctgatcagggcctcatctcaggttattttgtcccccggctgaatgtctacccgcagaggggacagggtaggggttgctgtatccttagcaaattaaatagttattttcatatagta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]