2024-04-25 10:07:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_035630396 2555 bp mRNA linear VRT 01-APR-2022 DEFINITION PREDICTED: Scophthalmus maximus Fas apoptotic inhibitory molecule 2b (faim2b), transcript variant X2, mRNA. ACCESSION XM_035630396 VERSION XM_035630396.2 DBLINK BioProject: PRJNA821077 KEYWORDS RefSeq. SOURCE Scophthalmus maximus (turbot) ORGANISM Scophthalmus maximus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Pleuronectiformes; Pleuronectoidei; Scophthalmidae; Scophthalmus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_061520) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Apr 1, 2022 this sequence version replaced XM_035630396.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Scophthalmus maximus Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2555 /organism="Scophthalmus maximus" /mol_type="mRNA" /strain="ysfricsl-2021" /db_xref="taxon:52904" /chromosome="6" /sex="female" /tissue_type="muscle" gene 1..2555 /gene="faim2b" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:118308928" CDS 261..1025 /gene="faim2b" /codon_start=1 /product="fas apoptotic inhibitory molecule 2b isoform X2" /protein_id="XP_035486289.2" /db_xref="GeneID:118308928" /translation="
MKKGKVNDDIEPPSYQVATADYEEMQAQFSWDDKTIRRTFIRKVYAILMVQLLVTVAIVGLFTFCAPVRFFIQTHPGLYMASYIMFFFTYIALSCCGDLRRQFPWNIILLVLFTLSISFMMGFVSSFYNTKSVLLCLGITALVCLSVTIFSFQSKIDVTSYQGVLFSLCMVMLLCAITISIVVPFGYVPWLHALYAVTGAVLFTLFLAFDTQMLLGNKRYSISPEEYIFATLSLYLDVIYLFSFLLQLLGGGRS"
misc_feature 348..1010 /gene="faim2b" /note="Proteins similar to and including lifeguard (LFG), a putative regulator of apoptosis; Region: LFG_like; cd10428" /db_xref="CDD:198410" ORIGIN
caggggtggacagggatcagggttagggagagattaaccacacggaggtccataaagcctcagtgtaatccgcacgccgcacagtcagactcagagcaacaacaactccaccaacgacaccttgctcacaagtcgctgtgtgttggaccaagcgtagacaattaaacaagacgagacctttttaaaatttgggatttaaaagacttcagatcaatcgtgggcgtcatcagaatcataaaggagcaaaaaagggaataatcatgaaaaagggaaaggtgaacgacgacattgagccgcccagctaccaggtggcaacagcagactatgaggagatgcaggctcagttctcctgggacgacaagaccatccggcgaaccttcatcaggaaggtctacgccattctcatggttcagctccttgtgaccgtggccattgttggtctcttcacattctgcgcacctgtgaggtttttcatccagacccatcctggcttgtacatggcatcttatatcatgttcttcttcacctacatcgcgctgtcctgctgtggagatctgaggaggcagtttccctggaacatcattctgctggttctctttactttgagcatttccttcatgatgggatttgtgtcaagcttttacaacaccaagtccgtgttgctgtgcctgggcatcacagctctggtgtgtctctctgtcaccatcttcagcttccagagcaagatcgatgtcacgtcgtaccagggcgtcctgttttccctgtgcatggtcatgcttctctgtgccatcaccatctccatcgttgtgccctttggatacgttccctggttacacgctctttatgcggtgacaggagccgtcctcttcactctgttcctggcatttgacactcagatgctgctagggaacaagcgctactccataagtccggaggaatacattttcgccaccctcagcctctacctggacgtcatctacctgttcagcttcctgctgcagctcctgggaggaggccgctcgtgaagagcctgatccaccccatcgtacacctgaaccgtttaaactctcagaccacctaggatttgttcctcccgtgctcaacatgagcacgggaggaacacgagcattaaattgaccccaagaggtggggtaatttctgatgaattaccccacctctctttttaaaacatgcattgaagctgaaagcaagtgagagtaatcggttcgttccatgcttttggttttgcaatcttgtgtgtacaatcttgctgctggtttggtcccgacatcgcctgtgtcatacctcactatagctgttcactgtactctggccattcctgtaaatctggttttgtgttaccgaagggtcggctgccgtcctcgctgtcccacagtgcgtgttcacacagtcattaggcccatcagtggacagaagcagccacagtcacagagttgggactctgtttttttgtctccatcactgagccaaaatggaaatctgcactttgaagctcagcagggttgagcttgttataatagccgagtgtttcacaagctgcacagataaggcttgttttacacttgtttgtttttttaatgcacggcatcataaaaatgaatgttttaatgtttgtgtttgtgtgtgtgtgtgtgatatatctgaagctcacaaagtccaacctcaaagggagagtgtgacagtactttctgtcattaaagatgcattttctcagtgacttgaatgtggcctttgggatgtgatagaaaagccgatgatcagagtgtgaaccgtagaaatgttttacctgtacagtaaatttacctggacacatgttaatattttttacaaagacattgaggctgtgtacattcaatattgtcatcattaaaataaacctaactcatgaacagtggtgtgcctggcttgcatgtaaaagacgatagatgtcattactgcagttctgtgttatgacattcaatcatttctgcacaactctgtgccgagacccccagatttacctcaactgcctcaagatctttgctttgactccaccgatctgctgagatatcatggcaaccaggccaaacaatttgtatcaggtcacagtgaccttgaccttctgatcagaacatctgtgagtgtttttgaatgtttgtgccaaatctgaagaaaccccttcgaggctgtcttgaaatattgcattcaagaggccaaaatgtgttttgtgaggtcacaatgaccttagctcaacttaagagtcaaagggaatatttatgccaaatgagtgtttcttatttttgtcctctgcccagagccgcatgtctcctcacctctcacacctaacatgcctaacagggcacttcttcacctgatctcctacactttgtcctacagaacatattgagctgtcggttcttaaccctcccataatagtcagggttcagtagcaatttctgctctaacatgcaacataaacatctttttttgaatcttactaggaaaacttggacccttgaaacaggatgtgaggacccagctgccgcaaacaggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]