GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 04:54:40, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_034408090             422 bp    mRNA    linear   VRT 15-MAY-2020
DEFINITION  PREDICTED: Pantherophis guttatus A disintegrin and
            metalloproteinase with thrombospondin motifs 13-like
            (LOC117660035), mRNA.
ACCESSION   XM_034408090
VERSION     XM_034408090.1
DBLINK      BioProject: PRJNA632598
KEYWORDS    RefSeq.
SOURCE      Pantherophis guttatus
  ORGANISM  Pantherophis guttatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Unidentata; Episquamata;
            Toxicofera; Serpentes; Colubroidea; Colubridae; Colubrinae;
            Pantherophis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_023041204.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pantherophis guttatus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..422
                     /organism="Pantherophis guttatus"
                     /mol_type="mRNA"
                     /isolate="EG266"
                     /db_xref="taxon:94885"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
     gene            1..422
                     /gene="LOC117660035"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 22 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:117660035"
     CDS             45..332
                     /gene="LOC117660035"
                     /codon_start=1
                     /product="A disintegrin and metalloproteinase with
                     thrombospondin motifs 13-like"
                     /protein_id="XP_034263981.1"
                     /db_xref="GeneID:117660035"
                     /translation="
MTGVQARICTVAIGRPLGEMITVQVLQSSLNCSAGEILLFSTRTMWRMACKKLKLLLVTTQTNTLMVRQRRLLSGSGVVLRYTSRLAEKKHHQGV"
ORIGIN      
gtatctgtggaaggcagtggctggatcccagcggactaatcaacatgacgggtgtacaagccaggatttgcacggtcgccataggccgccctttaggggagatgatcacagtccaggtgttgcagagttccttgaactgcagcgcaggagaaatattactcttttcgacacggacaatgtggcggatggcctgtaagaaactgaagctgttgctggtgaccacccaaaccaacaccctgatggtcaggcaacgccggctgttgtcgggcagtggcgttgtgctacggtacaccagccgattggcagagaagaaacaccatcaaggtgtgtagcccgtggaacggctcgccaccagaagttgtggatgctccaacactggaggttttcaagaagagattggacagcctttggtctgagatggg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]