GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 05:42:15, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_033639127            1824 bp    mRNA    linear   VRT 20-APR-2020
DEFINITION  PREDICTED: Epinephelus lanceolatus cysteine-rich and transmembrane
            domain-containing protein 1-like (LOC117264835), mRNA.
ACCESSION   XM_033639127
VERSION     XM_033639127.1
DBLINK      BioProject: PRJNA625542
KEYWORDS    RefSeq.
SOURCE      Epinephelus lanceolatus (giant grouper)
  ORGANISM  Epinephelus lanceolatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Eupercaria; Perciformes; Serranoidei; Serranidae;
            Epinephelinae; Epinephelini; Epinephelus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_046992.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Epinephelus lanceolatus Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1824
                     /organism="Epinephelus lanceolatus"
                     /mol_type="mRNA"
                     /isolate="Andai001"
                     /db_xref="taxon:310571"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="blood and muscle"
     gene            1..1824
                     /gene="LOC117264835"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:117264835"
     CDS             222..638
                     /gene="LOC117264835"
                     /codon_start=1
                     /product="cysteine-rich and transmembrane
                     domain-containing protein 1-like"
                     /protein_id="XP_033495018.1"
                     /db_xref="GeneID:117264835"
                     /translation="
MSNDNPPPYVPPVPGGPSAPGFSSAYSSQPATFPGSPYQTFPQTYTGGGDLSYYQGPAGPQGPPVPPGPYLTQPGYQGYQSGPWEGPKMYGEQPKHTVFVVDQNYDDGGADGAESCLAGCSAALCCCCLWDMLTQNFC"
ORIGIN      
tccatcggtcaacacgtcgatcaactggagcgacggcaacagagaaagttcatgttgtgacatttgacgcttcgtcctgagctgagagtccatccatccatccatccatccatccatccgtccatccatccatccatccatccatccatccatccgtccatccatccatccatccatccatccatccgtccatccgtccatccgtccgtccatctgtccccatgagtaatgataaccctcctccgtacgtccctcccgtccccggtggaccttcagctcccggcttctcttcagcttacagctctcagcctgcgacctttcctggctcaccataccagaccttccctcagacttacacaggtggaggagacctctcctactaccaaggaccggctggaccccaggggcccccggtgcccccggggccatacctgactcagcctgggtaccaggggtaccagagcggcccctgggagggccctaaaatgtacggagagcagccgaaacacacagtgttcgtggtcgatcaaaactatgacgacggcggcgctgacggagccgaatcgtgtctggcaggatgttcagctgctctgtgctgctgctgcctgtgggacatgttgacccaaaacttctgctgacctctgaccttcaccaccactgagcctcttctttcccatcatgcaccagggccaccataatgacaccaacctttgaccttttgaccttcattattttatcctgttagacatttgtgtcaagttcggtcagaattagtgaaagaatccttcagttatggccaaaaacacgtttgtgaggtcacagtgaccttggcttgtgtccaatctgacgtttgcgccaaattgaatagaaatcccatcaaagccgtcttgagtcacagggttcagaagaatgagacagacgtaaaggcacagtgacctttgaccttcaaattctaatcagctcattgttaagtccaagtgaaagtttgtgccatatttgaagaaattcccctgaggcattcttcagacatcgtgtcgacaaagatgagtcagacgaggtcacactgacctttttaccactaaagtctaatcagttcattgttcagtccaagtggacgttcatgccaaatttgaaaaaaaaacaaaaaaaaccttgaggtgttctcgagaggtcatgttagcgagaatgaaatggacgaggtcacggtgacctttaaagagataatcaccaaagtctaatcaggtcatcgtggagccccagtgaaagtttgtgccaaattaaaaaaaaaaatcccttaaggtttctgagatgtcgtgttcacatgttctcaagaatgagatggacaaagttacagtgacctttgaccttcaaaatctaatcagttcatcgttgactcaaagtggacgtttgtgccaaatttgaagaatttctcccgggatgttgttgacatatgatgttaaagagaacaggacagtgttcttacatagcggcggtggcggctcactgacattcatgataaatgttccagtgtttgagtcacagacgccgtcagtttcactaatgtgtttctctgttgtgtgtttttccccgacctcctgatgatgtcacacccctctgccaatgatgtgcctgcacatggcgggtcctgatctcagaccctgatgacatcataaaactatttttaatgaatcattgaatctgtttgaatttaggctaaaaacttgtttctaagtgtttacagtctcctcgtcttcacgtttcttgtgtgttaatgtttcttcacagttctgatgaagaggtcaataaaaagcttcgttaaaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]