2025-07-12 17:37:36, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_033596898 303 bp mRNA linear PLN 20-APR-2020 DEFINITION Didymella exigua CBS 183.55 uncharacterized protein (M421DRAFT_7266), partial mRNA. ACCESSION XM_033596898 VERSION XM_033596898.1 DBLINK BioProject: PRJNA625768 BioSample: SAMN02745736 KEYWORDS RefSeq. SOURCE Didymella exigua CBS 183.55 ORGANISM Didymella exigua CBS 183.55 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae; Didymellaceae; Didymella. REFERENCE 1 (bases 1 to 303) AUTHORS Haridas,S., Albert,R., Binder,M., Bloem,J., LaButti,K., Salamov,A., Andreopoulos,B., Baker,S., Barry,K., Bills,G., Bluhm,B., Cannon,C., Castanera,R., Culley,D., Daum,C., Ezra,D., Gonzalez,J., Henrissat,B., Kuo,A., Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J., Mondo,S., Nolan,M., Ohm,R., Pangilinan,J., Park,H.-J., Ramirez,L., Alfaro,M., Sun,H., Tritt,A., Yoshinaga,Y., Zwiers,L.-H., Turgeon,B., Goodwin,S., Spatafora,J., Crous,P. and Grigoriev,I. TITLE 101 Dothideomycetes genomes: a test case for predicting lifestyles and emergence of pathogens JOURNAL Stud. Mycol. (2020) In press REMARK DOI: 10.1016/j.simyco.2020.01.003 REFERENCE 2 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-APR-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 303) AUTHORS Kuo,A., Haridas,S., Albert,R., Binder,M., Bloem,J., Labutti,K., Salamov,A., Andreopoulos,B., Armaleo,D., Baker,S.E., Barry,K., Bills,G., Bluhm,B.H., Cannon,C., Castanera,R., Culley,D.E., Daum,C., Ezra,D., Gonzalez,J.B., Henrissat,B., Inderbitzin,P., Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J., Mondo,S., Nolan,M., Ohm,R., Pangilinan,J., Park,H.-J.H., Sanchez,M.A., Sun,H., Tritt,A., Zwiers,L.-H.L., Turgeon,B.G., Goodwin,S.B., Spatafora,J.W., Crous,P.W. and Grigoriev,I.V. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (05-AUG-2019) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_022984798). ##Metadata-START## Organism Display Name :: Didymella exigua CBS 183.55 v1.0 GOLD Stamp ID :: Gp0090695 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Didymella exigua CBS 183.55" /mol_type="mRNA" /strain="CBS 183.55" /culture_collection="CBS:183.55" /type_material="culture from neotype of Didymosphaeria exigua" /db_xref="taxon:1150837" /chromosome="Unknown" gene <1..>303 /locus_tag="M421DRAFT_7266" /db_xref="GeneID:54354565" CDS 1..303 /locus_tag="M421DRAFT_7266" /note="expressed protein" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_033446288.1" /db_xref="GeneID:54354565" /db_xref="JGIDB:Didex1_7266" /translation="
MPALSTANHTLSTANHTLSTANHTLSTANHTHPPTAHQTSEHPLDSPTAQPTRRYYARVPTDTHADAAEFVFRHTAPDRVKAEPTVLDRVKAVLGLRRRR"
ORIGIN
atgcccgccctctccacagcgaaccacaccctctccacggcgaaccacaccctctccacggcgaaccacaccctctccacagcgaaccacacacaccccccaaccgcccaccagacctcagagcaccccctcgactctccaaccgcccagccaacgaggcggtactacgcgcgcgtcccaacggacacgcacgccgacgcggctgagttcgtgttccgccacaccgcgcccgaccgcgtcaaggccgagccgacggttttggatcgcgtcaaggctgtgcttgggttgcggcggcggcgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]