ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-09 14:23:20, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_033596898 303 bp mRNA linear PLN 20-APR-2020
DEFINITION Didymella exigua CBS 183.55 uncharacterized protein
(M421DRAFT_7266), partial mRNA.
ACCESSION XM_033596898
VERSION XM_033596898.1
DBLINK BioProject: PRJNA625768
BioSample: SAMN02745736
KEYWORDS RefSeq.
SOURCE Didymella exigua CBS 183.55
ORGANISM Didymella exigua CBS 183.55
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
Didymellaceae; Didymella.
REFERENCE 1 (bases 1 to 303)
AUTHORS Haridas,S., Albert,R., Binder,M., Bloem,J., LaButti,K., Salamov,A.,
Andreopoulos,B., Baker,S., Barry,K., Bills,G., Bluhm,B., Cannon,C.,
Castanera,R., Culley,D., Daum,C., Ezra,D., Gonzalez,J.,
Henrissat,B., Kuo,A., Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J.,
Mondo,S., Nolan,M., Ohm,R., Pangilinan,J., Park,H.-J., Ramirez,L.,
Alfaro,M., Sun,H., Tritt,A., Yoshinaga,Y., Zwiers,L.-H.,
Turgeon,B., Goodwin,S., Spatafora,J., Crous,P. and Grigoriev,I.
TITLE 101 Dothideomycetes genomes: a test case for predicting lifestyles
and emergence of pathogens
JOURNAL Stud. Mycol. (2020) In press
REMARK DOI: 10.1016/j.simyco.2020.01.003
REFERENCE 2 (bases 1 to 303)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (17-APR-2020) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 303)
AUTHORS Kuo,A., Haridas,S., Albert,R., Binder,M., Bloem,J., Labutti,K.,
Salamov,A., Andreopoulos,B., Armaleo,D., Baker,S.E., Barry,K.,
Bills,G., Bluhm,B.H., Cannon,C., Castanera,R., Culley,D.E.,
Daum,C., Ezra,D., Gonzalez,J.B., Henrissat,B., Inderbitzin,P.,
Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J., Mondo,S., Nolan,M.,
Ohm,R., Pangilinan,J., Park,H.-J.H., Sanchez,M.A., Sun,H.,
Tritt,A., Zwiers,L.-H.L., Turgeon,B.G., Goodwin,S.B.,
Spatafora,J.W., Crous,P.W. and Grigoriev,I.V.
CONSRTM DOE Joint Genome Institute
TITLE Direct Submission
JOURNAL Submitted (05-AUG-2019) DOE Joint Genome Institute, 2800 Mitchell
Drive, Walnut Creek, CA 94598-1698, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_022984798).
##Metadata-START##
Organism Display Name :: Didymella exigua CBS 183.55 v1.0
GOLD Stamp ID :: Gp0090695
##Metadata-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..303
/organism="Didymella exigua CBS 183.55"
/mol_type="mRNA"
/strain="CBS 183.55"
/culture_collection="CBS:183.55"
/type_material="culture from neotype of Didymosphaeria
exigua"
/db_xref="taxon:1150837"
/chromosome="Unknown"
gene <1..>303
/locus_tag="M421DRAFT_7266"
/db_xref="GeneID:54354565"
CDS 1..303
/locus_tag="M421DRAFT_7266"
/note="expressed protein"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_033446288.1"
/db_xref="GeneID:54354565"
/db_xref="JGIDB:Didex1_7266"
/translation="
MPALSTANHTLSTANHTLSTANHTLSTANHTHPPTAHQTSEHPLDSPTAQPTRRYYARVPTDTHADAAEFVFRHTAPDRVKAEPTVLDRVKAVLGLRRRR"
ORIGIN
atgcccgccctctccacagcgaaccacaccctctccacggcgaaccacaccctctccacggcgaaccacaccctctccacagcgaaccacacacaccccccaaccgcccaccagacctcagagcaccccctcgactctccaaccgcccagccaacgaggcggtactacgcgcgcgtcccaacggacacgcacgccgacgcggctgagttcgtgttccgccacaccgcgcccgaccgcgtcaaggccgagccgacggttttggatcgcgtcaaggctgtgcttgggttgcggcggcggcgctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]