LOCUS       XM_033596898             303 bp    mRNA    linear   PLN 20-APR-2020
DEFINITION  Didymella exigua CBS 183.55 uncharacterized protein
            (M421DRAFT_7266), partial mRNA.
ACCESSION   XM_033596898
VERSION     XM_033596898.1
DBLINK      BioProject: PRJNA625768
            BioSample: SAMN02745736
KEYWORDS    RefSeq.
SOURCE      Didymella exigua CBS 183.55
  ORGANISM  Didymella exigua CBS 183.55
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae;
            Didymellaceae; Didymella.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Haridas,S., Albert,R., Binder,M., Bloem,J., LaButti,K., Salamov,A.,
            Andreopoulos,B., Baker,S., Barry,K., Bills,G., Bluhm,B., Cannon,C.,
            Castanera,R., Culley,D., Daum,C., Ezra,D., Gonzalez,J.,
            Henrissat,B., Kuo,A., Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J.,
            Mondo,S., Nolan,M., Ohm,R., Pangilinan,J., Park,H.-J., Ramirez,L.,
            Alfaro,M., Sun,H., Tritt,A., Yoshinaga,Y., Zwiers,L.-H.,
            Turgeon,B., Goodwin,S., Spatafora,J., Crous,P. and Grigoriev,I.
  TITLE     101 Dothideomycetes genomes: a test case for predicting lifestyles
            and emergence of pathogens
  JOURNAL   Stud. Mycol. (2020) In press
  REMARK    DOI: 10.1016/j.simyco.2020.01.003
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-APR-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Kuo,A., Haridas,S., Albert,R., Binder,M., Bloem,J., Labutti,K.,
            Salamov,A., Andreopoulos,B., Armaleo,D., Baker,S.E., Barry,K.,
            Bills,G., Bluhm,B.H., Cannon,C., Castanera,R., Culley,D.E.,
            Daum,C., Ezra,D., Gonzalez,J.B., Henrissat,B., Inderbitzin,P.,
            Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J., Mondo,S., Nolan,M.,
            Ohm,R., Pangilinan,J., Park,H.-J.H., Sanchez,M.A., Sun,H.,
            Tritt,A., Zwiers,L.-H.L., Turgeon,B.G., Goodwin,S.B.,
            Spatafora,J.W., Crous,P.W. and Grigoriev,I.V.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (05-AUG-2019) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_022984798).
            
            ##Metadata-START##
            Organism Display Name :: Didymella exigua CBS 183.55 v1.0
            GOLD Stamp ID         :: Gp0090695
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Didymella exigua CBS 183.55"
                     /mol_type="mRNA"
                     /strain="CBS 183.55"
                     /culture_collection="CBS:183.55"
                     /type_material="culture from neotype of Didymosphaeria
                     exigua"
                     /db_xref="taxon:1150837"
                     /chromosome="Unknown"
     gene            <1..>303
                     /locus_tag="M421DRAFT_7266"
                     /db_xref="GeneID:54354565"
     CDS             1..303
                     /locus_tag="M421DRAFT_7266"
                     /note="expressed protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_033446288.1"
                     /db_xref="GeneID:54354565"
                     /db_xref="JGIDB:Didex1_7266"
                     /translation="

MPALSTANHTLSTANHTLSTANHTLSTANHTHPPTAHQTSEHPLDSPTAQPTRRYYARVPTDTHADAAEFVFRHTAPDRVKAEPTVLDRVKAVLGLRRRR"

ORIGIN      

atgcccgccctctccacagcgaaccacaccctctccacggcgaaccacaccctctccacggcgaaccacaccctctccacagcgaaccacacacaccccccaaccgcccaccagacctcagagcaccccctcgactctccaaccgcccagccaacgaggcggtactacgcgcgcgtcccaacggacacgcacgccgacgcggctgagttcgtgttccgccacaccgcgcccgaccgcgtcaaggccgagccgacggttttggatcgcgtcaaggctgtgcttgggttgcggcggcggcgctga

//