2024-04-25 21:32:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_033354380 1406 bp mRNA linear INV 23-FEB-2022 DEFINITION PREDICTED: Belonocnema kinseyi dehydrodolichyl diphosphate synthase complex subunit DHDDS (LOC117168696), transcript variant X3, mRNA. ACCESSION XM_033354380 VERSION XM_033354380.1 DBLINK BioProject: PRJNA623416 KEYWORDS RefSeq. SOURCE Belonocnema kinseyi ORGANISM Belonocnema kinseyi Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Proctotrupomorpha; Cynipoidea; Cynipidae; Cynipinae; Cynipini; Belonocnema. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_046659.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Updated annotation Annotation Name :: Belonocnema kinseyi Updated Annotation Release 100.20220217 Annotation Version :: 100.20220217 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; propagated RefSeq model Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1406 /organism="Belonocnema kinseyi" /mol_type="mRNA" /isolate="2016_QV_RU_SX_M_011" /host="Quercus virginiana" /db_xref="taxon:2817044" /chromosome="3" /sex="male" /tissue_type="whole body" /dev_stage="Sexual adult" /country="USA: Houston" /collection_date="2017" gene 1..1406 /gene="LOC117168696" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:117168696" CDS 183..1073 /gene="LOC117168696" /codon_start=1 /product="dehydrodolichyl diphosphate synthase complex subunit DHDDS" /protein_id="XP_033210271.1" /db_xref="GeneID:117168696" /translation="
MSWIRDSTLNWIQRLAVKIVKSGQIPRHVAFIMDGNRRYANKKNVEKVEGHTQGFYKLTETLQWCLELGVPEVTVYAFSIENFKRSKEEVDGLMDLARKKFQGLLDERDKLMENGVCIRVVGNLSLIPEDVQKLIAEAMIITKDNSKAVLNLAFSYTSRDEITQAVKDVVDGVKSTELLVEDINEDLINDCLYTHKSPEPDLLIRTSGEIRLSDFLLWQITSTCIYFAEVLWPEFTVWDLLAAVLYYQRCTYDLRLVAKKVESKHLICNNRITSYICNVYKQRQMFIENISQTAVQ"
misc_feature 264..929 /gene="LOC117168696" /note="Cis (Z)-Isoprenyl Diphosphate Synthases; Region: Cis_IPPS; cd00475" /db_xref="CDD:259850" misc_feature order(279..296,321..323,333..335,345..347,354..356, 411..413,435..437,447..449,468..473,480..482,636..638, 795..797,813..815,819..821) /gene="LOC117168696" /note="active site" /db_xref="CDD:259850" misc_feature order(657..662,666..671,678..683,729..737,744..746, 777..779,810..824,831..839,843..857,861..863) /gene="LOC117168696" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:259850" ORIGIN
tgtcttaacgcgttatattctcctttatttaatgtttaatagttgtttcaagtcttctgaaaatgtgacacctctttgctacaaactcgatgtagatattgattcgaaattatattttcataaaatataatttttatatataaaaagtcaatttccaactttgactcaacgtgaaagaaaaaatgtcttggatacgagatagcactttaaattggattcagcgtttagctgtcaaaatcgtaaaaagtggtcaaattcctagacatgttgcatttataatggacggaaataggcgttatgcgaataagaaaaatgtagaaaaagttgaaggacatacgcaaggattttacaaattaacagaaacattgcagtggtgtttagaacttggagttcccgaagttactgtttacgcattcagtatagagaatttcaaaagaagtaaagaggaagttgatggcctcatggatctagctagaaaaaaattccaaggccttttagatgaaagagataaattaatggaaaacggagtttgtatacgagtagttggaaatttatctctcataccagaggatgttcaaaagttaattgcagaagccatgattattacgaaagacaatagcaaagcagttctcaatttggcattttcttacacctcaagagacgagattacccaagcagtcaaggatgtcgttgacggagttaaaagtaccgaattattggtggaagatataaacgaagatctcataaatgattgtttgtacactcacaaatctccggaacccgatttattgattcgcacatctggagaaatacgtttgagtgattttctcctgtggcaaattacaagtacttgcatttattttgcggaagtactttggccagaattcactgtatgggacttacttgccgcagttttatattatcaaaggtgtacatatgatttgagattggtagctaagaaggttgaaagcaaacatttaatttgcaacaacagaattacttcctacatttgtaatgtatataaacagagacaaatgttcatagaaaatatatcgcagactgcagttcagtgattagaattgaatgtaacttttgttttatgatttttaaattggcaaaagtagtatccgtcgcaatagcaaaatacgaatgaaatttttgccagaaaaacggattacttcttgggaatatatttaaaaagaaactcgacattagttttttattttggccacgagtacgagtgtttgagattgaagtagtaaatattaatttctacagtcatgtaaatatgtagaatatttgcatttctacttgcgatttactggaacatgtacatatttttattatattgtattgagcacaatattttcgatgaatttaaataaatttgtttaaatttgaacaac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]