LOCUS       XM_033261808            1176 bp    mRNA    linear   INV 30-MAR-2020
DEFINITION  PREDICTED: Anneissia japonica low-density lipoprotein
            receptor-related protein 4-like (LOC117117502), partial mRNA.
ACCESSION   XM_033261808
VERSION     XM_033261808.1
DBLINK      BioProject: PRJNA615663
KEYWORDS    RefSeq.
SOURCE      Anneissia japonica
  ORGANISM  Anneissia japonica
            Eukaryota; Metazoa; Echinodermata; Pelmatozoa; Crinoidea;
            Articulata; Comatulida; Comatulidae; Comatulinae; Anneissia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022738099.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Anneissia japonica Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Anneissia japonica"
                     /mol_type="mRNA"
                     /isolate="Jap-2015-1"
                     /db_xref="taxon:1529436"
                     /chromosome="Unknown"
                     /tissue_type="sperms"
                     /country="Japan: Sagami Bay (Misaki)"
                     /collection_date="01-Jan-2016"
     gene            <1..>1176
                     /gene="LOC117117502"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 48 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:117117502"
     CDS             <1..>1176
                     /gene="LOC117117502"
                     /codon_start=1
                     /product="low-density lipoprotein receptor-related protein
                     4-like"
                     /protein_id="XP_033117699.1"
                     /db_xref="GeneID:117117502"
                     /translation="

NSDEVDCAAPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCNNGKCIPTGWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCNNGNCIPVGWKCGGTDDCGDNSDEVDCAPPTCSSDQFQCNNGNCITTGWKCDRTDDCGDNSDEVDCAPPTCSSGQFQCENGKCIPTRWKCDRTDDCGDNSDEVDCAAPTCSYGQFQCDNGNCIPTGWKCDGTDDCGDNSDEVDCVPPTCSSGQFQCENGKCIPTRWKCDRTDDCGDNSDEVDCAPPTCSSEQFQCNNGNCIPTGWKCDRTDDCGDNSDEVDCAPPTCSSGQFPCENGKCIPTRWKCDRTDDCGDNSDEVHCAPPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNS"

     misc_feature    34..138
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(49..51,73..75,106..111)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(85..87,94..96,106..108,124..129)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    115..129
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    151..255
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(166..168,190..192,223..228)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(202..204,211..213,223..225,241..246)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    232..246
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    268..372
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(283..285,307..309,340..345)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(319..321,328..330,340..342,358..363)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    349..363
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    385..489
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(400..402,424..426,457..462)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(436..438,445..447,457..459,475..480)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    466..480
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    502..606
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(517..519,541..543,574..579)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(553..555,562..564,574..576,592..597)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    583..597
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    619..723
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(634..636,658..660,691..696)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(670..672,679..681,691..693,709..714)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    700..714
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    736..840
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(751..753,775..777,808..813)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(787..789,796..798,808..810,826..831)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    817..831
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    853..957
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(868..870,892..894,925..930)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(904..906,913..915,925..927,943..948)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    934..948
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    970..1074
                     /gene="LOC117117502"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(985..987,1009..1011,1042..1047)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(1021..1023,1030..1032,1042..1044,1060..1065)
                     /gene="LOC117117502"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    1051..1065
                     /gene="LOC117117502"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    1084..1176
                     /gene="LOC117117502"
                     /note="Low-density lipoprotein receptor domain class A;
                     Region: LDLa; smart00192"
                     /db_xref="CDD:197566"
     misc_feature    order(1102..1104,1126..1128,1159..1164)
                     /gene="LOC117117502"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
ORIGIN      

aactcagatgaggtcgactgtgctgctccaacatgctcatctggacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgattgtggcgataactcagatgaagtcgactgcgcagctccaacatgctcatctgaacaatttcaatgcaataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgacgactgtggcgataactcagatgaggtcgactgtgctgctccaacatgctcatctgaacaatttcaatgcaataatggtaactgtataccagtaggttggaaatgcggtggtaccgatgactgtggcgataattcagatgaggtcgactgcgctcctccaacatgctcatctgatcaattccaatgcaataatggtaactgtataacaacaggttggaaatgcgaccgtaccgatgactgtggcgataattcagatgaggtcgactgcgctccaccaacatgctcatctggacaattccaatgcgaaaatggtaaatgtataccaacccgttggaaatgcgaccgtaccgatgactgtggagacaactcagatgaggtcgactgtgctgctccaacatgctcatatggacagttccaatgtgataatggtaactgtataccaacaggttggaaatgcgatggtaccgatgactgtggtgataactcagatgaggtcgactgcgttcctccaacatgctcatctggacaattccaatgcgaaaatggtaaatgtataccaacccgttggaaatgcgaccgtaccgatgactgtggcgataactcagatgaggtcgactgcgctcctccaacatgctcatctgaacaatttcaatgcaataatggtaactgtataccaacaggttggaaatgcgaccgtaccgacgactgtggcgataattcagatgaggtcgactgcgctccaccaacatgctcatctggacaattcccatgcgaaaatggtaaatgtataccaacccgttggaaatgcgaccgtaccgatgactgtggagacaactcagatgaggtccactgcgctcctccaacatgctcatctggacagttccaatgtgataacggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggcgataactca

//