GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-29 14:42:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_033246269             949 bp    mRNA    linear   INV 30-MAR-2020
DEFINITION  PREDICTED: Anneissia japonica low-density lipoprotein
            receptor-related protein 4-like (LOC117105200), partial mRNA.
ACCESSION   XM_033246269
VERSION     XM_033246269.1
DBLINK      BioProject: PRJNA615663
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Anneissia japonica
  ORGANISM  Anneissia japonica
            Eukaryota; Metazoa; Echinodermata; Pelmatozoa; Crinoidea;
            Articulata; Comatulida; Comatulidae; Comatulinae; Anneissia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022705078.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Anneissia japonica Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..949
                     /organism="Anneissia japonica"
                     /mol_type="mRNA"
                     /isolate="Jap-2015-1"
                     /db_xref="taxon:1529436"
                     /chromosome="Unknown"
                     /tissue_type="sperms"
                     /country="Japan: Sagami Bay (Misaki)"
                     /collection_date="01-Jan-2016"
     gene            <1..>949
                     /gene="LOC117105200"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 26 Proteins, and 97% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:117105200"
     CDS             <1..>949
                     /gene="LOC117105200"
                     /codon_start=1
                     /product="low-density lipoprotein receptor-related protein
                     4-like"
                     /protein_id="XP_033102160.1"
                     /db_xref="GeneID:117105200"
                     /translation="
WKCDGTDDCGDNSDEVDCAAPTCSSEQFQCNNGNCIPTGWKCDRTDDCGDNSDEVDCAPPTCSSGQFQCENGKCIPTRWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAAPICSSEQFQCDNGKCIPVGWKCEGFDDCGDNSDEVDCAAPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCDNGKCIPTGWKCDRTDDCDDNSDEVDCTAPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAPPTCRPDEFQCDNGKCIPTRWKCD"
     misc_feature    67..171
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(82..84,106..108,139..144)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(118..120,127..129,139..141,157..162)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    148..162
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    184..288
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(199..201,223..225,256..261)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(235..237,244..246,256..258,274..279)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    265..279
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    301..405
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(316..318,340..342,373..378)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(352..354,361..363,373..375,391..396)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    382..396
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    418..522
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(433..435,457..459,490..495)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(469..471,478..480,490..492,508..513)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    499..513
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    535..639
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(550..552,574..576,607..612)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(586..588,595..597,607..609,625..630)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    616..630
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    652..756
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(667..669,691..693,724..729)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(703..705,712..714,724..726,742..747)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    733..747
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    769..873
                     /gene="LOC117105200"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(784..786,808..810,841..846)
                     /gene="LOC117105200"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(820..822,829..831,841..843,859..864)
                     /gene="LOC117105200"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    850..864
                     /gene="LOC117105200"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
ORIGIN      
tggaaatgcgatggtaccgatgactgtggcgataattcagatgaggtcgactgcgctgctccaacatgctcatctgaacaatttcaatgcaataatggtaactgtataccaacaggttggaaatgcgaccgtaccgacgactgtggtgataattcagatgaggtcgactgcgctcctccaacatgctcatctggacaattccaatgcgaaaatggtaaatgtataccaacccgttggaaatgcgaccgtaccgatgactgtggagacaactctgatgaggtcgactgtgctgctccaacatgctcatctgaacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggcgataactcagatgaggtcgactgcgctgctccaatatgttcatctgaacaatttcagtgtgataatgggaaatgcataccagtaggttggaaatgtgagggtttcgatgactgtggtgataactcagatgaggtcgactgcgctgctccaacatgctcatctggacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggtgataactcagatgaggtcgactgcgctgctccaacatgctcatctgaacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtgacgataactcagatgaggtcgactgcactgctccaacatgctcatctggacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggcgataattcagatgaggtagactgcgctcctccaacatgccgaccagatgagttccaatgcgataatggtaaatgtataccaacccgttggaaatgcgacc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]