2024-03-29 14:42:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_033246269 949 bp mRNA linear INV 30-MAR-2020 DEFINITION PREDICTED: Anneissia japonica low-density lipoprotein receptor-related protein 4-like (LOC117105200), partial mRNA. ACCESSION XM_033246269 VERSION XM_033246269.1 DBLINK BioProject: PRJNA615663 KEYWORDS RefSeq; includes ab initio. SOURCE Anneissia japonica ORGANISM Anneissia japonica Eukaryota; Metazoa; Echinodermata; Pelmatozoa; Crinoidea; Articulata; Comatulida; Comatulidae; Comatulinae; Anneissia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022705078.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Anneissia japonica Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..949 /organism="Anneissia japonica" /mol_type="mRNA" /isolate="Jap-2015-1" /db_xref="taxon:1529436" /chromosome="Unknown" /tissue_type="sperms" /country="Japan: Sagami Bay (Misaki)" /collection_date="01-Jan-2016" gene <1..>949 /gene="LOC117105200" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:117105200" CDS <1..>949 /gene="LOC117105200" /codon_start=1 /product="low-density lipoprotein receptor-related protein 4-like" /protein_id="XP_033102160.1" /db_xref="GeneID:117105200" /translation="
WKCDGTDDCGDNSDEVDCAAPTCSSEQFQCNNGNCIPTGWKCDRTDDCGDNSDEVDCAPPTCSSGQFQCENGKCIPTRWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAAPICSSEQFQCDNGKCIPVGWKCEGFDDCGDNSDEVDCAAPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAAPTCSSEQFQCDNGKCIPTGWKCDRTDDCDDNSDEVDCTAPTCSSGQFQCDNGKCIPTGWKCDRTDDCGDNSDEVDCAPPTCRPDEFQCDNGKCIPTRWKCD"
misc_feature 67..171 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(82..84,106..108,139..144) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(118..120,127..129,139..141,157..162) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 148..162 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 184..288 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(199..201,223..225,256..261) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(235..237,244..246,256..258,274..279) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 265..279 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 301..405 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(316..318,340..342,373..378) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(352..354,361..363,373..375,391..396) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 382..396 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 418..522 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(433..435,457..459,490..495) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(469..471,478..480,490..492,508..513) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 499..513 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 535..639 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(550..552,574..576,607..612) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(586..588,595..597,607..609,625..630) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 616..630 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 652..756 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(667..669,691..693,724..729) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(703..705,712..714,724..726,742..747) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 733..747 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" misc_feature 769..873 /gene="LOC117105200" /note="Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about...; Region: LDLa; cd00112" /db_xref="CDD:238060" misc_feature order(784..786,808..810,841..846) /gene="LOC117105200" /note="putative binding surface [active]" /db_xref="CDD:238060" misc_feature order(820..822,829..831,841..843,859..864) /gene="LOC117105200" /note="calcium-binding site [ion binding]; other site" /db_xref="CDD:238060" misc_feature 850..864 /gene="LOC117105200" /note="D-X-S-D-E motif; other site" /db_xref="CDD:238060" ORIGIN
tggaaatgcgatggtaccgatgactgtggcgataattcagatgaggtcgactgcgctgctccaacatgctcatctgaacaatttcaatgcaataatggtaactgtataccaacaggttggaaatgcgaccgtaccgacgactgtggtgataattcagatgaggtcgactgcgctcctccaacatgctcatctggacaattccaatgcgaaaatggtaaatgtataccaacccgttggaaatgcgaccgtaccgatgactgtggagacaactctgatgaggtcgactgtgctgctccaacatgctcatctgaacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggcgataactcagatgaggtcgactgcgctgctccaatatgttcatctgaacaatttcagtgtgataatgggaaatgcataccagtaggttggaaatgtgagggtttcgatgactgtggtgataactcagatgaggtcgactgcgctgctccaacatgctcatctggacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggtgataactcagatgaggtcgactgcgctgctccaacatgctcatctgaacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtgacgataactcagatgaggtcgactgcactgctccaacatgctcatctggacagttccaatgtgataatggtaaatgcataccaacaggttggaaatgcgatcgtaccgatgactgtggcgataattcagatgaggtagactgcgctcctccaacatgccgaccagatgagttccaatgcgataatggtaaatgtataccaacccgttggaaatgcgacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]