GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 15:15:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_033208077            1093 bp    mRNA    linear   PRI 28-MAR-2020
DEFINITION  PREDICTED: Trachypithecus francoisi copper chaperone for superoxide
            dismutase (CCS), transcript variant X2, mRNA.
ACCESSION   XM_033208077
VERSION     XM_033208077.1
DBLINK      BioProject: PRJNA614514
KEYWORDS    RefSeq.
SOURCE      Trachypithecus francoisi (Francois's langur)
  ORGANISM  Trachypithecus francoisi
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Colobinae; Trachypithecus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022681473.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Trachypithecus francoisi Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1093
                     /organism="Trachypithecus francoisi"
                     /mol_type="mRNA"
                     /isolate="TF-2019V2"
                     /db_xref="taxon:54180"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="muscle"
     gene            1..1093
                     /gene="CCS"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 139 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     40 samples with support for all annotated introns"
                     /db_xref="GeneID:117081743"
     CDS             164..931
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_033063968.1"
                     /db_xref="GeneID:117081743"
                     /translation="
MTCQSCVDAVRKSLQGVAGVQDVEVHLENQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSDQLQNLGAAVAILGGPGPVQGVVRFLQLSPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGDHFNPDGASHGGPQDSDRHRGDLGNVHADADGCAIFRMEDEKLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGQRLACGIIASSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL"
     misc_feature    164..865
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      
ccccgcgacgctgcgctggttgatcctcctgcgtccgaagagttccgcgtttcgggctggtgactgggtccagaatggcttcggactcggggaaccaggggactctctgcacgcgatcatcgttcggtccctgccgcccttgcagttggagttcgcggtgcagatgacctgtcagagctgtgtggacgctgtgcgcaagtccctgcaaggggtggcaggtgtccaggatgtggaggtgcacttggagaatcagatggtcttggtacacaccactctgcccagccaggaggtgcaggctctcctggaaggcacggggcggcaggcagtactcaagggcatgggcagcgaccagttgcagaatctgggagcagcagtggccatcctgggggggcctggccccgtgcagggggtggtgcgcttcctacagctgagccctgagcgctgcctcatcgagggaactattgatggcctggagcctgggttgcatggactccatgtccatcagtatggggacctcacaaacaactgcaacagctgtggggaccactttaaccctgatggagcatctcatgggggcccccaggactctgaccggcaccgcggagacctgggcaatgtccatgctgatgctgatggctgcgccatcttcagaatggaggatgagaagctgaaggtgtgggatgtgattggccgcagcctgattattgatgagggagaagatgacctgggccggggaggccatcccttatccaagatcacagggaactctgggcagaggttggcctgcggcatcatcgcgagctccgctggcctcttccagaaccccaagcagatctgctcttgcgatggcctcactatctgggaggagcgaggccggcccatcgctggcaagggccgaaaggagtcagcccagccccctgcccacctttgagcaggacctcaccttggctctgttgctgtcctccagggcgagcactttcctcttccagagggggccagagggaccttgcctgcccagtctttggagagctcagtacagggcaggagctgctgcggtgttcccttggcaaatgagttttattttcatttggga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]