2024-05-19 15:15:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_033208077 1093 bp mRNA linear PRI 28-MAR-2020 DEFINITION PREDICTED: Trachypithecus francoisi copper chaperone for superoxide dismutase (CCS), transcript variant X2, mRNA. ACCESSION XM_033208077 VERSION XM_033208077.1 DBLINK BioProject: PRJNA614514 KEYWORDS RefSeq. SOURCE Trachypithecus francoisi (Francois's langur) ORGANISM Trachypithecus francoisi Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Cercopithecidae; Colobinae; Trachypithecus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022681473.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Trachypithecus francoisi Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1093 /organism="Trachypithecus francoisi" /mol_type="mRNA" /isolate="TF-2019V2" /db_xref="taxon:54180" /chromosome="Unknown" /sex="male" /tissue_type="muscle" gene 1..1093 /gene="CCS" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 139 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 40 samples with support for all annotated introns" /db_xref="GeneID:117081743" CDS 164..931 /gene="CCS" /codon_start=1 /product="copper chaperone for superoxide dismutase isoform X2" /protein_id="XP_033063968.1" /db_xref="GeneID:117081743" /translation="
MTCQSCVDAVRKSLQGVAGVQDVEVHLENQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSDQLQNLGAAVAILGGPGPVQGVVRFLQLSPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGDHFNPDGASHGGPQDSDRHRGDLGNVHADADGCAIFRMEDEKLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGQRLACGIIASSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL"
misc_feature 164..865 /gene="CCS" /note="copper, zinc superoxide dismutase; Region: PLN02957" /db_xref="CDD:215516" ORIGIN
ccccgcgacgctgcgctggttgatcctcctgcgtccgaagagttccgcgtttcgggctggtgactgggtccagaatggcttcggactcggggaaccaggggactctctgcacgcgatcatcgttcggtccctgccgcccttgcagttggagttcgcggtgcagatgacctgtcagagctgtgtggacgctgtgcgcaagtccctgcaaggggtggcaggtgtccaggatgtggaggtgcacttggagaatcagatggtcttggtacacaccactctgcccagccaggaggtgcaggctctcctggaaggcacggggcggcaggcagtactcaagggcatgggcagcgaccagttgcagaatctgggagcagcagtggccatcctgggggggcctggccccgtgcagggggtggtgcgcttcctacagctgagccctgagcgctgcctcatcgagggaactattgatggcctggagcctgggttgcatggactccatgtccatcagtatggggacctcacaaacaactgcaacagctgtggggaccactttaaccctgatggagcatctcatgggggcccccaggactctgaccggcaccgcggagacctgggcaatgtccatgctgatgctgatggctgcgccatcttcagaatggaggatgagaagctgaaggtgtgggatgtgattggccgcagcctgattattgatgagggagaagatgacctgggccggggaggccatcccttatccaagatcacagggaactctgggcagaggttggcctgcggcatcatcgcgagctccgctggcctcttccagaaccccaagcagatctgctcttgcgatggcctcactatctgggaggagcgaggccggcccatcgctggcaagggccgaaaggagtcagcccagccccctgcccacctttgagcaggacctcaccttggctctgttgctgtcctccagggcgagcactttcctcttccagagggggccagagggaccttgcctgcccagtctttggagagctcagtacagggcaggagctgctgcggtgttcccttggcaaatgagttttattttcatttggga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]