 ver.2
Home
|
Help
|
Advanced search
  
Previous release (v1)
ver.2
Home
|
Help
|
Advanced search
  
Previous release (v1)
2025-10-31 12:31:37, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS       XM_032035952             531 bp    mRNA    linear   PLN 26-JUN-2024
DEFINITION  Colletotrichum fructicola Nara gc5 uncharacterized protein
            (CGGC5_v007378), partial mRNA.
ACCESSION   XM_032035952
VERSION     XM_032035952.2
DBLINK      BioProject: PRJNA225509
            BioSample: SAMN02981487
KEYWORDS    RefSeq.
SOURCE      Colletotrichum fructicola Nara gc5
  ORGANISM  Colletotrichum fructicola Nara gc5
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Hypocreomycetidae; Glomerellales; Glomerellaceae;
            Colletotrichum; Colletotrichum gloeosporioides species complex.
REFERENCE   1  (bases 1 to 531)
  AUTHORS   Gan,P. and Shirasu,K.
  TITLE     Genome sequencing and assembly of multiple isolates from the
            Colletotrichum gloeosporioides species complex
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 531)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 531)
  AUTHORS   Gan,P. and Shirasu,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-APR-2020) RIKEN Center for Sustainable Resource
            Science, RIKEN, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa
            230-0045, Japan
REFERENCE   4  (bases 1 to 531)
  AUTHORS   Gan,P.H.P., Ikeda,K., Irieda,H., Narusaka,M., O'Connell,R.J.,
            Narusaka,Y., Takano,Y., Kubo,Y. and Shirasu,K.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-AUG-2012) RIKEN Plant Science Center, RIKEN Yokohama
            Institute, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa
            230-0045, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027094054).
            
            On Jun 26, 2024 this sequence version replaced XM_032035952.1.
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..531
                     /organism="Colletotrichum fructicola Nara gc5"
                     /mol_type="mRNA"
                     /strain="Nara gc5"
                     /isolation_source="infected strawberry"
                     /host="strawberry"
                     /db_xref="taxon:1213859"
                     /chromosome="Unknown"
     gene            <1..>531
                     /locus_tag="CGGC5_v007378"
                     /old_locus_tag="CGMCC3_g8427"
                     /db_xref="GeneID:43619952"
     CDS             1..531
                     /locus_tag="CGGC5_v007378"
                     /old_locus_tag="CGMCC3_g8427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_031885177.2"
                     /db_xref="GeneID:43619952"
                     /translation="
MGIPSFLPTELIKEHMYNSSTDNPPLGPSALTTYIERALIAVRRHNAKTKNRNKRLGDQQQTEQEQPDATGGPNVNLEEVENTLHQRDEQIATLQQQLTENEEFSQQQLSEKDELLAQKDELLARKNEVLVQKDELLAEQTSSIAELKELLRHKDEEMSRRTRELAELGRLWDTRS"
     misc_feature    232..>498
                     /locus_tag="CGGC5_v007378"
                     /old_locus_tag="CGMCC3_g8427"
                     /note="phosphodiesterase; Provisional; Region: PRK12704"
                     /db_xref="CDD:237177"
ORIGIN      
atggggataccctccttcctgccaacagagctcatcaaggagcacatgtacaactcttctacagacaacccgcctctgggcccatcagcgctcaccacgtacattgagcgagccctcatcgccgttcgccgccacaatgcaaagaccaagaatcgcaacaagcgtttgggcgaccagcagcagaccgaacaagagcagcccgatgcgacaggtgggcccaacgtcaacttagaggaggtagaaaacactctacatcaaagagacgaacaaatcgccacgcttcaacagcagctgactgagaacgaggagttttcccaacagcagctgagtgaaaaggacgaacttttggctcaaaaggatgagcttttggctcgaaagaacgaggtattggttcaaaaagacgagcttttggctgagcagaccagctcgatagcggaactcaaagagttgctccgccataaggatgaggaaatgtctcgacggacacgagaattagcggagttgggacgtttgtgggacactcgttcctga
//
by
@meso_cacase at 
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]