GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 21:53:33, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       XM_031895692            2268 bp    mRNA    linear   VRT 18-DEC-2019
DEFINITION  PREDICTED: Xenopus tropicalis claudin 8, gene 4 (cldn8.4),
            transcript variant X1, mRNA.
ACCESSION   XM_031895692
VERSION     XM_031895692.1
DBLINK      BioProject: PRJNA205740
KEYWORDS    RefSeq.
SOURCE      Xenopus tropicalis (tropical clawed frog)
  ORGANISM  Xenopus tropicalis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae;
            Xenopus; Silurana.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_030678.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Xenopus tropicalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2268
                     /organism="Xenopus tropicalis"
                     /mol_type="mRNA"
                     /strain="Nigerian"
                     /db_xref="taxon:8364"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="liver and blood"
                     /dev_stage="adult"
                     /note="F17 inbred"
     gene            1..2268
                     /gene="cldn8.4"
                     /gene_synonym="claudin-8"
                     /note="claudin 8, gene 4; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     ESTs, 48 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 23 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:100145356"
                     /db_xref="Xenbase:XB-GENE-991592"
     CDS             269..949
                     /gene="cldn8.4"
                     /gene_synonym="claudin-8"
                     /codon_start=1
                     /product="claudin 8, gene 2 isoform X1"
                     /protein_id="XP_031751552.1"
                     /db_xref="GeneID:100145356"
                     /db_xref="Xenbase:XB-GENE-991592"
                     /translation="
MALQLVGLVLGGIGLIGTCAVTGMPQWRVTAFIDNNIVVFEAQWEGLWMNCVRQANIRMQCKVYDSLLALTPDLQAGRALMCVAVCLTFLSFMIAIIGMKCTVCVGDNARTKGIILLVAGITFILSGIVVLIPVSWTGNQIIRDFYNPLVLSSQKRELGDALYIGWTTALVLIAGGLILCCTFRSGEKEVRYSLPPKSVTSAPPPKSAISVPIRKPSSLYSKSQYV"
ORIGIN      
aatattacagttctaacagtaaagaatccatattggtataagcacacctctttagactatcatatcattggctgggaaagctgtcagacctgataaacaagcactttcagttgtgtttgatttttgaaaagcggagcacataaaattccaaccagcccgtgccggatttcacttggtcgcaggtgttttagtcactttcttcagcggagagtaagagtttcagtttgctgcacacactgtactgctgagctccatctgggaagacaatatggctttgcaacttgttggtctggtgttgggaggcattggcttgataggaacttgtgctgtcaccggcatgccccaatggagagtgactgccttcattgataacaacattgtggtgtttgaggcacagtgggaaggattgtggatgaactgtgtcaggcaagccaacatcaggatgcagtgcaaggtatatgattcactgttggcactgacacctgacttgcaggctggcagagcactgatgtgcgtggctgtctgcttgacattcctttctttcatgatcgccatcattggcatgaaatgcaccgtgtgtgttggagataatgcaagaacaaaagggattatacttctggtagctggcataacattcatcctttctgggattgtggttctgattccagtatcctggactggtaatcagataatcagggacttctacaatcctcttgttctttcatcgcagaagagagagctgggtgatgctctgtacattggctggaccacagcattggtacttattgctggagggctaattctttgctgtacattccggagcggtgaaaaagaagtcagatacagcctgcctcctaaatcggtaaccagtgctccaccgcctaagtcagcaatcagtgttccaatacggaagccatcaagcctctactccaaaagccaatatgtgtaggaaggactacctagagctggagatcccctgtagacaaagtaggacttgcaaaggactgactttctttggactacataatgggagagtaagagtgaaccatttgagaatgtgtacagtggtcttaacacaggacttgtggttttggggaacaaataccaagaatcatgagcttatggacatttgcagctaacaggaaaaaggattttttgtttttttttctgcaccagaatatttcctttcaactgccatgcaaactgaagacaaagtgactttaactcaactcttgatcttcggtacaattgtaagctctgagggtaacctacaaaatgaagccatcccatgggaatggccgttgaacatctgcggtagggcagggcccaagcaggttttctgtatgtgcattgtaaggtagcgtgaattcttataacactcattatgcaatttaataattagcactgcagggcacccattcctgcagctgccaatgttccctatttatagcgtttactttacacttttactgttttccctgaaatgaattgttaggagcttatcatttttccttcaaattatactttaaaatgattttctgagcattagctaagccagcctttctataattttgtagatttttgtagaagtaaagagtgataatggtctaaatttttatttcaacccaaaacatcagaggaacaccaggccaaaccttagtgctgccttttggtgactttgaataaaagacttttgttgcccctttgcccatcccagccgtagacttgccatccccaaaccattgagttcccagggtaaaaaaaaaatcacacagttttattagtaggtgctcttgtgacttgaaggcaatattatgaacggcatagtggggagttattttcaatttcctatatatttttttttataattgtatataaaaatgcattagtatatacaggcaggggcattactgctgtttagattattattgtaacacaggcacacaatatacaatttactattgtattataatataatgcaaacacttataattggttaataacaataagtcttcaggttccaggatacattggattcaaactctgtctgcagtgaattaggctgtagcaaatgctttatattggaaactacccaagacttataaccattcctatttaacggagccctcgggtgttgctgtatacaatgctgttttgaaatatctatacatccagttaagctaaatagtcagtcttcctatattaatgtaaatgtgttgaaactgtataaataaagaataataaataataaaaacccttataacctca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]