2024-05-20 10:06:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_031676272 957 bp mRNA linear MAM 22-NOV-2019 DEFINITION PREDICTED: Vicugna pacos potassium-transporting ATPase alpha chain 2-like (LOC102525540), partial mRNA. ACCESSION XM_031676272 VERSION XM_031676272.1 DBLINK BioProject: PRJNA221631 KEYWORDS RefSeq. SOURCE Vicugna pacos (alpaca) ORGANISM Vicugna pacos Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Tylopoda; Camelidae; Vicugna. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022039240.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Vicugna pacos Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..957 /organism="Vicugna pacos" /mol_type="mRNA" /isolate="Carlotta (AHFN-0088)" /db_xref="taxon:30538" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" gene <1..957 /gene="LOC102525540" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:102525540" CDS <1..354 /gene="LOC102525540" /codon_start=1 /product="potassium-transporting ATPase alpha chain 2-like" /protein_id="XP_031532132.1" /db_xref="GeneID:102525540" /translation="
DAIVAVTGDGVNDSPALKKADIGIAMGIAGSDAAKNAADTVLLDDNFASIVTGVEEGRLIFDNLKKTIAYTLTKNIAELCPFLIYIIASLPLPIGTITMLFIDLGTDMVSSRKGSRL"
misc_feature <4..>333 /gene="LOC102525540" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
gatgctattgtcgctgtgacgggggatggagttaacgactctccggctctaaagaaggcagacattgggattgccatggggatcgcaggttctgatgcagccaaaaatgcagccgacacggtcttgctggatgacaacttcgcgtccatagtcacaggggtggaggaaggccgcctgatctttgacaacctgaagaagactatcgcgtacaccctgaccaagaacatcgctgagctctgcccctttcttatctacatcatcgccagcctgcccctgcccattggcaccattactatgttgttcatcgacctgggcacagatatggtaagtagcaggaaaggcagcaggctctgataacttccccggggtgtcagcctcagagtttttaccttcaggggcaagaggtggactaaatcgtgcttctcaaacctcagcgtgagggggcctgaagttctgaatttctaacaagctctaaagtgacaccgatctgctggtccccaaccacacttcaaagcaaagggctagagagatgtgtcaaatgtttggaaattaaaaccacttcactgtacatacgaacttttcaaggtgtgaattcttcacctttcaaaaaaatgccattggtcagttgcagctcatgtgcctcccttttcttttaagaagatgcagctctcatcagaacagccctgtgccactggggatccagcggctaagtaataacccacaactgccccttgttaaggaatcatctgtctggaagcccctctctaagtgcagtaagaagtggtggtcattcgcactgtgtggcctcacgttgacctgcagtaacgtcctctagtgcgaatccacttaagaatgctttgtgcattcgttcttaagggtctggctgacacgggcggcagggagccagtggagcccccttctcattcctacaacacccaggcaaccaccgcactacag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]