2024-05-20 06:52:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_031611835 344 bp mRNA linear VRT 16-NOV-2019 DEFINITION PREDICTED: Phasianus colchicus potassium-transporting ATPase alpha chain 1-like (LOC116241223), partial mRNA. ACCESSION XM_031611835 VERSION XM_031611835.1 DBLINK BioProject: PRJNA589599 KEYWORDS RefSeq; includes ab initio. SOURCE Phasianus colchicus (Ring-necked pheasant) ORGANISM Phasianus colchicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae; Phasianinae; Phasianus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022213059.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Phasianus colchicus Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..344 /organism="Phasianus colchicus" /mol_type="mRNA" /isolate="SZU-A5-319" /db_xref="taxon:9054" /chromosome="Unknown" /sex="male" /tissue_type="blood" gene 1..>344 /gene="LOC116241223" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 99% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:116241223" CDS 59..>344 /gene="LOC116241223" /codon_start=1 /product="potassium-transporting ATPase alpha chain 1-like" /protein_id="XP_031467695.1" /db_xref="GeneID:116241223" /translation="
MVFFMAIVVADVPEGLLATVTVCLSLTAKRLARKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVAHLWFDNQIHAADTTEDQSGTWGGGYG"
misc_feature <59..>325 /gene="LOC116241223" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
gtccctatggggtgcaggaggtccctatggggtcatcgggtcccccttcctccgggccatggtcttcttcatggccatcgtggtggccgacgtccccgaggggctgctggccaccgtcaccgtttgcctctccctgacggcgaagcgtctggcgaggaagaactgcgtggtgaagaacctggaggccgtggagaccttgggctccacgtcggtcatctgctccgacaaaaccgggaccctcacccaaaacaggatgactgtggcacatctgtggttcgacaaccagatccacgccgccgacaccaccgaggaccaatccggtacttgggggggcggttatgggg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]