GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 08:09:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_031420155             852 bp    mRNA    linear   PLN 22-OCT-2019
DEFINITION  PREDICTED: Pistacia vera CST complex subunit TEN1-like
            (LOC116134465), transcript variant X9, mRNA.
ACCESSION   XM_031420155
VERSION     XM_031420155.1
DBLINK      BioProject: PRJNA578116
KEYWORDS    RefSeq.
SOURCE      Pistacia vera
  ORGANISM  Pistacia vera
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae; Pistacia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_022196100.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Pistacia vera Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..852
                     /organism="Pistacia vera"
                     /mol_type="mRNA"
                     /cultivar="Batoury"
                     /db_xref="taxon:55513"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /country="China"
     gene            1..852
                     /gene="LOC116134465"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:116134465"
     CDS             209..589
                     /gene="LOC116134465"
                     /codon_start=1
                     /product="CST complex subunit TEN1-like isoform X3"
                     /protein_id="XP_031276015.1"
                     /db_xref="GeneID:116134465"
                     /translation="
MASSAIKSGALVTLPELNPSSQFFEEGASLRVTGKLQEYSVETAIAIIADGSAILKIDTQHLRDLSFRVGSIYQFIGELHIQLDNEAILQARVGRNVDGLDLNLYHQSLQLLRQFQAERYNNLMQL"
     misc_feature    224..565
                     /gene="LOC116134465"
                     /note="Telomere-capping, CST complex subunit; Region:
                     Ten1_2; pfam15490"
                     /db_xref="CDD:434751"
ORIGIN      
tttaaattttggtggttgattttgtttcgatttttcttccaaaaattttgcttttataactgtcgtttaagttattttatatcacaagaagagattgtgatctttgactttaatggggttcttgttgccgttatgaagttttcaggttagtttgttgtgtgtggagtgtagcttgctggcgctttttgagtgagttggtggcagtttgatggcatcctcggcaataaaatctggggcattggttactttaccagagttaaacccatcatctcaattctttgaagaaggagcttcgctaagagttactgggaagttacaagagtattccgtggagacagccatagccataattgctgatggaagtgccatcttaaagatcgacacccagcacctgagggaccttagttttcgagttgggtccatctatcagtttattggtgaactccatattcagcttgacaatgaggcaatcttgcaggcacgagtaggtaggaatgttgatggccttgacctgaacctgtatcatcagtcattgcagctactgagacagtttcaagctgagcggtacaacaacttaatgcagttataaaattaaacaggctcactcagagggaaaggtaccaaagtaacttcgtacctacatgtagacgtgttgaaaatggatgatttttttttccttttttaattctttcagtatttaactgttggatctctactacgaatacttaattcatcgttgatatctattaaatgtccatcaaaatatacgctgttataatttctgatttcctctggagcatagaaactgggtaatctgttcatttatgacagattcccacctttaagattgaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]