2024-04-29 08:09:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_031420155 852 bp mRNA linear PLN 22-OCT-2019 DEFINITION PREDICTED: Pistacia vera CST complex subunit TEN1-like (LOC116134465), transcript variant X9, mRNA. ACCESSION XM_031420155 VERSION XM_031420155.1 DBLINK BioProject: PRJNA578116 KEYWORDS RefSeq. SOURCE Pistacia vera ORGANISM Pistacia vera Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Anacardiaceae; Pistacia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_022196100.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Pistacia vera Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..852 /organism="Pistacia vera" /mol_type="mRNA" /cultivar="Batoury" /db_xref="taxon:55513" /chromosome="Unknown" /tissue_type="leaf" /country="China" gene 1..852 /gene="LOC116134465" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:116134465" CDS 209..589 /gene="LOC116134465" /codon_start=1 /product="CST complex subunit TEN1-like isoform X3" /protein_id="XP_031276015.1" /db_xref="GeneID:116134465" /translation="
MASSAIKSGALVTLPELNPSSQFFEEGASLRVTGKLQEYSVETAIAIIADGSAILKIDTQHLRDLSFRVGSIYQFIGELHIQLDNEAILQARVGRNVDGLDLNLYHQSLQLLRQFQAERYNNLMQL"
misc_feature 224..565 /gene="LOC116134465" /note="Telomere-capping, CST complex subunit; Region: Ten1_2; pfam15490" /db_xref="CDD:434751" ORIGIN
tttaaattttggtggttgattttgtttcgatttttcttccaaaaattttgcttttataactgtcgtttaagttattttatatcacaagaagagattgtgatctttgactttaatggggttcttgttgccgttatgaagttttcaggttagtttgttgtgtgtggagtgtagcttgctggcgctttttgagtgagttggtggcagtttgatggcatcctcggcaataaaatctggggcattggttactttaccagagttaaacccatcatctcaattctttgaagaaggagcttcgctaagagttactgggaagttacaagagtattccgtggagacagccatagccataattgctgatggaagtgccatcttaaagatcgacacccagcacctgagggaccttagttttcgagttgggtccatctatcagtttattggtgaactccatattcagcttgacaatgaggcaatcttgcaggcacgagtaggtaggaatgttgatggccttgacctgaacctgtatcatcagtcattgcagctactgagacagtttcaagctgagcggtacaacaacttaatgcagttataaaattaaacaggctcactcagagggaaaggtaccaaagtaacttcgtacctacatgtagacgtgttgaaaatggatgatttttttttccttttttaattctttcagtatttaactgttggatctctactacgaatacttaattcatcgttgatatctattaaatgtccatcaaaatatacgctgttataatttctgatttcctctggagcatagaaactgggtaatctgttcatttatgacagattcccacctttaagattgaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]