LOCUS       XM_031251101             607 bp    mRNA    linear   PLN 17-OCT-2019
DEFINITION  PREDICTED: Ipomoea triloba heavy metal-associated isoprenylated
            plant protein 7-like (LOC116011700), mRNA.
ACCESSION   XM_031251101
VERSION     XM_031251101.1
DBLINK      BioProject: PRJNA574454
KEYWORDS    RefSeq.
SOURCE      Ipomoea triloba (trilobed morning glory)
  ORGANISM  Ipomoea triloba
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae;
            Ipomoeeae; Ipomoea.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_044918.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ipomoea triloba Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..607
                     /organism="Ipomoea triloba"
                     /mol_type="mRNA"
                     /cultivar="NCNSP0323"
                     /db_xref="taxon:35885"
                     /chromosome="3"
                     /tissue_type="Young leaf"
                     /dev_stage="Seedling"
                     /country="USA: Raleigh"
     gene            1..607
                     /gene="LOC116011700"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:116011700"
     CDS             34..462
                     /gene="LOC116011700"
                     /codon_start=1
                     /product="heavy metal-associated isoprenylated plant
                     protein 7-like"
                     /protein_id="XP_031106961.1"
                     /db_xref="GeneID:116011700"
                     /translation="

MGRLSFGKALDSLCLFSGSSLSSGSCFCSNGFDSPDDFEKKPFISPKVAGQVVKLKDVVAGPPTLAFHLKPKTVVLRVSMHCKSCAKKVEKHISKMEGVSSYQIDMETKMVVVIGDVVPFEVLESVSKVKNAQLWTTAPHLT"

     misc_feature    256..417
                     /gene="LOC116011700"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(271..279,286..288)
                     /gene="LOC116011700"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
ORIGIN      

taggcttaatttctgataatcttgatcatcaagatggggaggctcagttttggcaaggcgttggattctttgtgcctgttttctggatcatcattatcgtcagggtcttgcttttgcagcaatggttttgacagtccagatgattttgagaagaagcctttcattagtcctaaagtagcagggcaggtggtcaagttgaaggatgttgttgcaggacctcccaccttggcttttcacctcaagcctaagacagtggtgctaagggtctccatgcactgcaaaagctgtgcaaagaaagtggagaaacatatctccaagatggaaggagtgagttcatatcaaatagacatggaaacgaagatggtagtggtgataggtgatgttgtgcctttcgaagtgttggagagtgtttcaaaggttaaaaatgcccagctttggaccactgctcctcaccttacttaattcatatatgcatccttctcatgtttatatattgaagttaattttgtatgtaaatttcaagtggccatatgatgttaaagaatcgaggaagtttagcttgtgtttcaataataatgcttgtgaaagctccaaaaattgatagcaa

//