GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:50:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_031168257             279 bp    mRNA    linear   PLN 09-OCT-2019
DEFINITION  Synchytrium microbalum uncharacterized protein (SmJEL517_g02329),
            partial mRNA.
ACCESSION   XM_031168257
VERSION     XM_031168257.1
DBLINK      BioProject: PRJNA576245
            BioSample: SAMN08987497
KEYWORDS    RefSeq.
SOURCE      Synchytrium microbalum
  ORGANISM  Synchytrium microbalum
            Eukaryota; Fungi; Fungi incertae sedis; Chytridiomycota;
            Chytridiomycota incertae sedis; Chytridiomycetes; Synchytriales;
            Synchytriaceae; Synchytrium.
REFERENCE   1  (bases 1 to 279)
  AUTHORS   van de Vossenberg,B.T.L.H., Warris,S., Nguyen,H.D.T., van
            Gent-Pelzer,M.P.E., Joly,D.L., van de Geest,H.C., Bonants,P.J.M.,
            Smith,D.S., Levesque,C.A. and van der Lee,T.A.J.
  TITLE     Comparative genomics of chytrid fungi reveal insights into the
            obligate biotrophic and pathogenic lifestyle of Synchytrium
            endobioticum
  JOURNAL   Sci Rep 9 (1), 8672 (2019)
   PUBMED   31209237
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 279)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (08-OCT-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 279)
  AUTHORS   van de Vossenberg,B.T.L.H., Warris,S., Nguyen,H.D.T., van
            Gent-Pelzer,M.P.E., Joly,D.L., van de Geest,H.C., Bonants,P.J.M.,
            Smith,D.S., Levesque,C.A. and van der Lee,T.A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2018) Science and Technology Branch, Agriculture
            and Agri-Food Canada, 960 Carling Ave., Ottawa, Ontario K1A 0C6,
            Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_022158358).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..279
                     /organism="Synchytrium microbalum"
                     /mol_type="mRNA"
                     /strain="JEL517"
                     /isolation_source="spruce pollen"
                     /type_material="culture from holotype of Synchytrium
                     microbalum"
                     /db_xref="taxon:1806994"
                     /chromosome="Unknown"
                     /country="USA: Maine, Hancock Co."
                     /collection_date="2006"
                     /collected_by="Joyce Longcore"
     gene            <1..>279
                     /locus_tag="SmJEL517_g02329"
                     /db_xref="GeneID:42003554"
     CDS             1..279
                     /locus_tag="SmJEL517_g02329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_031025744.1"
                     /db_xref="GeneID:42003554"
                     /translation="
MSTYLQGDGVNDNIRTVRSLPIRKDDEVTIVRGTAKGREGTVIQVYRLKYFLRIEKNTKDKVNVVITNAKMDVDRPPLPSLRGVAAVNGLSP"
     misc_feature    <49..225
                     /locus_tag="SmJEL517_g02329"
                     /note="an acronym for the authors' surnames (Kyrpides,
                     Ouzounis and Woese); Region: KOW; cl00354"
                     /db_xref="CDD:444860"
ORIGIN      
atgtctacctatctccaaggagatggtgtcaacgataacatcagaactgttcgctcattacctattcgcaaagacgacgaagttaccatcgtcagaggaacagccaaaggtcgtgaaggcacagtcattcaagtgtaccgcttaaaatacttcctacgcattgaaaagaatacaaaggacaaggtcaatgtagtcatcaccaacgcaaaaatggatgttgatagaccaccacttccttccttgagaggtgttgctgctgttaacggattgtctccgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]