LOCUS       XM_030122003            2015 bp    mRNA    linear   VRT 02-AUG-2019
DEFINITION  PREDICTED: Sphaeramia orbicularis tubulin gamma complex associated
            protein 4 (tubgcp4), transcript variant X2, mRNA.
ACCESSION   XM_030122003
VERSION     XM_030122003.1
DBLINK      BioProject: PRJNA556027
KEYWORDS    RefSeq.
SOURCE      Sphaeramia orbicularis (orbiculate cardinalfish)
  ORGANISM  Sphaeramia orbicularis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Neoteleostei;
            Acanthomorphata; Gobiaria; Kurtiformes; Apogonoidei; Apogonidae;
            Apogoninae; Sphaeramia.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_043959.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Sphaeramia orbicularis Annotation
                                           Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2015
                     /organism="Sphaeramia orbicularis"
                     /mol_type="mRNA"
                     /db_xref="taxon:375764"
                     /chromosome="3"
     gene            1..2015
                     /gene="tubgcp4"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:115410369"
     CDS             120..1733
                     /gene="tubgcp4"
                     /codon_start=1
                     /product="gamma-tubulin complex component 4 isoform X2"
                     /protein_id="XP_029977863.1"
                     /db_xref="GeneID:115410369"
                     /translation="

MIHELLLALSGYPGTIFPWNKRTGLQVSQDLPFLHPSETSVLNRLCKLGSDYIRFTEFIEQHTGHVHQQEHHTSQPSQTGLHGSYLRAFCTGLDSTLQPYRQTLLDLEQEFLCDPHLTISHANYKLDQFQLLFPSVMVVVETIKAQKIHGCQILETVYKHSCGGLPPVRTALEKILAVCHGVMYKQLAAWMLHGLLLDQSEEFYVKQGPSAGGAAANQEEEEEDLGLGGLSGKQLRELQDLRLIEEENMLAPSLQQFSLRTEMLPSYIPVRVAEKILFVGESVQMFENHNHSPSRAGSILKHQEDLFAAELHRLKQQPLFSLVDFENLIDHIRSTVAEHLWTLMVEESDLLEQLKIIKDFYLLGRGELYQVFIDLAQHMLKTPPTAVTEHDVNVAFQQAAHKVLLDDDNLLPLLHLTVDYQGKDSKDAIGPRDGATPPQDTSPREIPPTGWAALGLTYKVQWPLHILFTPAVLEKYNVVFRYLLSVRRVQSQLQHCWALQMQRKHLKSSQTDAIKWRLRNHMAFLIDNLQYYLQVGP"

     misc_feature    123..1160
                     /gene="tubgcp4"
                     /note="Gamma tubulin complex component N-terminal; Region:
                     GCP_N_terminal; pfam17681"
                     /db_xref="CDD:435971"
     misc_feature    1167..>1724
                     /gene="tubgcp4"
                     /note="Spc97 / Spc98 family; Region: Spc97_Spc98;
                     pfam04130"
                     /db_xref="CDD:427731"
ORIGIN      

acatgcgacggccggagcgccgcaacggaggaggtttatttgggtggtagactactgcttaatttaccttcaaaaagaatagattgggtgtaatactcctctataataaaagctgcaggatgattcacgagctactgttggctctgagcggatatccgggaactattttcccctggaacaaacggaccggattgcaggtatcccaggacctgcccttcctccatcccagtgagaccagtgtcctgaacagactctgtaaactgggatcagattacatccgcttcacagagttcatcgagcagcacacgggacacgtgcaccagcaggaacatcacacatctcagcccagtcagactggactccatgggagctacctgagagccttctgcaccggactggactcaaccctgcagccgtacagacagacgctgttggacctggagcaggagttcctctgtgaccctcacctgaccatctcccatgccaactataaactggatcagttccagctgctgtttccgtctgtgatggtggtggtggagaccataaaggctcagaagatccacggctgtcagatcctggagacggtttataaacacagctgtggaggacttccacctgttcgcacggctctggagaagatcctggcggtctgtcatggtgtcatgtacaaacagctggcggcctggatgctccatggtttactgctggaccagagtgaggagttctacgtgaaacagggtccgagtgcaggaggagcagcagccaatcaggaggaggaggaggaggacctgggcttaggaggactgagcgggaaacagctgcgagagcttcaggacctgaggctgatcgaggaggagaacatgctcgctccgtctctgcagcagttctccctccggaccgagatgctgccgtcgtacatccctgtcagggtcgccgagaagatcctgtttgtgggagaatcagttcagatgtttgagaaccacaaccacagcccatccagagctggttccatcctgaagcaccaggaggacctgtttgccgccgagctgcaccgactcaaacagcagcctctgttcagtctggtggacttcgaaaacctcatcgaccacatcaggagcaccgtggcagagcatctgtggacactgatggtggaggaatcggaccttctggaacagctcaagatcattaaggacttctacttgctgggtcgtggtgagctctaccaggttttcatcgacctcgcgcagcacatgctgaagaccccgccaacggccgtcacagagcacgacgttaacgtggcatttcaacaggcggctcataaagttctactggacgacgataacctgctgcctctgctgcacctgacagtcgactatcagggcaaagacagtaaagatgcaattggtcccagagatggagccacacccccacaggacacctcacctcgagaaatcccgcccaccggctgggcggctctcggcctcacctataaagtccagtggcctctgcacatcctgttcactccggccgtcctcgagaagtacaacgttgtgttcaggtacctgctgagtgttcggagagtccagtctcagctgcagcactgctgggccctgcagatgcagaggaaacacctcaaatccagtcagacggacgccatcaagtggagactccgcaaccacatggcctttttgatcgacaacttgcagtactacctgcaggtaggaccttgaacgcaccacagtactacctataggtaggaccttgaatgcaccgcagtactacttacaggtaggaccttgaacgcaccgcagtactacttacaggtaggaccttgaacgcaccacagttctccctgtggctgagaaccccatgtggttctctgtacttgttcggttcataatgaaaccctgacaccgtttgtacataaatgaaccggatccattgatgtgtcagtgaatctgtggacagaaacaacaggacataaaaaatgggcccagattcacctcgtgtct

//