GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-12-06 04:39:50, GGRNA.v2 : RefSeq release 208 (Sep, 2021)

LOCUS       XM_029888794             285 bp    mRNA    linear   PLN 12-JUL-2019
DEFINITION  Pyricularia pennisetigena uncharacterized protein (PpBr36_01609),
            partial mRNA.
ACCESSION   XM_029888794
VERSION     XM_029888794.1
DBLINK      BioProject: PRJNA554126
            BioSample: SAMN10496236
KEYWORDS    RefSeq.
SOURCE      Pyricularia pennisetigena
  ORGANISM  Pyricularia pennisetigena
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Magnaporthales;
            Pyriculariaceae; Pyricularia.
REFERENCE   1  (bases 1 to 285)
  AUTHORS   Gomez Luciano,L.B., Jason Tsai,I., Chuma,I., Tosa,Y., Chen,Y.H.,
            Li,J.Y., Li,M.Y., Jade Lu,M.Y., Nakayashiki,H. and Li,W.H.
  TITLE     Blast fungal genomes show frequent chromosomal changes, gene gains
            and losses, and effector gene turnover
  JOURNAL   Mol. Biol. Evol. (2019) In press
   PUBMED   30835262
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 285)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 285)
  AUTHORS   Gomez Luciano,L.B., Tsai,I.J., Chuma,I., Tosa,Y., Lu,M.-Y.J.,
            Nakayashiki,H. and Li,W.-H.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2018) Biodiversity Research Center, Academia
            Sinica, 128 Academia Road, Sec. 2, Nankang, Taipei 11529, Taiwan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_043741).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..285
                     /organism="Pyricularia pennisetigena"
                     /mol_type="mRNA"
                     /strain="Br36"
                     /host="Cenchrus echinatus"
                     /db_xref="taxon:1578925"
                     /chromosome="2"
                     /country="Brazil: Parana"
                     /collection_date="1990"
     gene            <1..>285
                     /locus_tag="PpBr36_01609"
                     /db_xref="GeneID:40731099"
     CDS             1..285
                     /locus_tag="PpBr36_01609"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_029750761.1"
                     /db_xref="GeneID:40731099"
                     /translation="
MTSVVPHKCGDNGGFRCAKPPRPSPGSTVQPNGTPCEVLQKPISHPILHEGSNSPHDVPASFSGSGWIAETNKDEVIVTCRSLVHHRAKPHSVR"
ORIGIN      
atgacatcagtggtcccacacaagtgtggcgacaatggagggttccgctgcgccaagcccccccggccttctcccggcagtacagtacaaccaaacggaacgccatgcgaggtgttgcaaaagccgatttcccatcccatcctgcacgaagggtccaactcgcctcatgacgttcccgcctccttcagcggtagcggttggatcgccgagacaaacaaggacgaggtcatcgtgacctgccgcagcttagtacaccaccgcgccaaacctcattcagttcgttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]