ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-11-17 19:41:48, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_029800585 609 bp mRNA linear INV 08-OCT-2020
DEFINITION PREDICTED: Octopus sinensis stress response protein NST1-like
(LOC115230060), mRNA.
ACCESSION XM_029800585
VERSION XM_029800585.1
DBLINK BioProject: PRJNA551489
KEYWORDS RefSeq; includes ab initio.
SOURCE Octopus sinensis (East Asian common octopus)
ORGANISM Octopus sinensis
Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca;
Cephalopoda; Coleoidea; Octopodiformes; Octopoda; Incirrata;
Octopodidae; Octopus.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_042997.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Octopus sinensis Annotation Release
101
Annotation Version :: 101
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.5
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..609
/organism="Octopus sinensis"
/mol_type="mRNA"
/db_xref="taxon:2607531"
/linkage_group="LG1"
gene 1..609
/gene="LOC115230060"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:115230060"
CDS 1..609
/gene="LOC115230060"
/codon_start=1
/product="stress response protein NST1-like"
/protein_id="XP_029656445.1"
/db_xref="GeneID:115230060"
/translation="
MNRYDELVRRTDESVRRKDESVRSKDESVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDELVRRTDESVGRKDESVRSKDEPVRRKDELVRRKDESVRRKDELVRRKDESVRRKDESVRRKDELVRRKDESVRRKDESVQRKDESVRCKDESVQRKDELVRRKDESVRRKDESWNAGCGEYHAQLK"
misc_feature <46..573
/gene="LOC115230060"
/note="MAEBL; Provisional; Region: PTZ00121"
/db_xref="CDD:173412"
ORIGIN
atgaatcggtacgatgaattagtacgacgcacagatgaatcggtacgacgtaaagatgaatcggtacgaagcaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgcaaagatgaatcggtacgacgtaaagatgaattagtacgacgtaaagatgaattagtacgacgcacagatgaatcggtaggacgtaaagatgaatcggtacgaagcaaagatgaaccggtacgacgcaaagatgaattagtacgacgcaaagatgaatcggtacgacgcaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcggtacgacgcaaagatgaattagtacgacgcaaagatgaatctgtacgacgtaaagatgaatcggtacaacgtaaagatgaatcggtacgatgcaaagatgaatcggtacaacgtaaagatgaattagtacgacgtaaagatgaatcggtacgacgtaaagatgaatcatggaacgctggatgtggcgaatatcacgcacagttaaaatag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]