GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 22:20:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_029749688            1476 bp    mRNA    linear   VRT 01-JUL-2019
DEFINITION  PREDICTED: Salmo trutta uncharacterized LOC115191777
            (LOC115191777), mRNA.
ACCESSION   XM_029749688
VERSION     XM_029749688.1
DBLINK      BioProject: PRJNA550988
KEYWORDS    RefSeq.
SOURCE      Salmo trutta (river trout)
  ORGANISM  Salmo trutta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042960.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Salmo trutta Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1476
                     /organism="Salmo trutta"
                     /mol_type="mRNA"
                     /db_xref="taxon:8032"
                     /chromosome="4"
     gene            1..1476
                     /gene="LOC115191777"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:115191777"
     CDS             296..1363
                     /gene="LOC115191777"
                     /codon_start=1
                     /product="uncharacterized protein LOC115191777"
                     /protein_id="XP_029605548.1"
                     /db_xref="GeneID:115191777"
                     /translation="
MKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFRLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMEHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMEHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFRLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLRFTPLDHYILKPQ"
ORIGIN      
tgactccaacctgagtgtatggaaacttccgacttcaactgtatatcagtccactacaaaggtctatatggtcgctaataatagtaaaggcccagtgcactacttttgtgagtaaaatatattttcaaaaaagtatatatttttgttttcatatattttgtttttatacagattgttagggggtgctgcagcctcctggtcagctttagtctgtcaagccagacaagctcttatcctttcacgtctatgaaaacagtcagtctgggaatgcaccaggagacagggaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttccgactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatggaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatggaacaccagcctcttgggtttctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtgattatgaaacaccagcctcttgggttccgactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtgattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttcggttcactccacttgaccactacattctcaaacctcagtgactaaaactggatggactttctgccttgacccctgccttgaccccacttatgtttgacagatgtctgcttcaagtcagttttgaatccacaattgtttctaaattggagaccct
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]