2024-05-05 22:20:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_029749688 1476 bp mRNA linear VRT 01-JUL-2019 DEFINITION PREDICTED: Salmo trutta uncharacterized LOC115191777 (LOC115191777), mRNA. ACCESSION XM_029749688 VERSION XM_029749688.1 DBLINK BioProject: PRJNA550988 KEYWORDS RefSeq. SOURCE Salmo trutta (river trout) ORGANISM Salmo trutta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_042960.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Salmo trutta Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1476 /organism="Salmo trutta" /mol_type="mRNA" /db_xref="taxon:8032" /chromosome="4" gene 1..1476 /gene="LOC115191777" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:115191777" CDS 296..1363 /gene="LOC115191777" /codon_start=1 /product="uncharacterized protein LOC115191777" /protein_id="XP_029605548.1" /db_xref="GeneID:115191777" /translation="
MKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFRLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMEHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMEHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFRLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLGFLLQYPTVIMKHQPLRFTPLDHYILKPQ"
ORIGIN
tgactccaacctgagtgtatggaaacttccgacttcaactgtatatcagtccactacaaaggtctatatggtcgctaataatagtaaaggcccagtgcactacttttgtgagtaaaatatattttcaaaaaagtatatatttttgttttcatatattttgtttttatacagattgttagggggtgctgcagcctcctggtcagctttagtctgtcaagccagacaagctcttatcctttcacgtctatgaaaacagtcagtctgggaatgcaccaggagacagggaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttccgactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatggaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatggaacaccagcctcttgggtttctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtgattatgaaacaccagcctcttgggttccgactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttgggttcctactgcagtatccaacagtgattatgaaacaccagcctcttgggttcctactgcagtatccaacagtcattatgaaacaccagcctcttcggttcactccacttgaccactacattctcaaacctcagtgactaaaactggatggactttctgccttgacccctgccttgaccccacttatgtttgacagatgtctgcttcaagtcagttttgaatccacaattgtttctaaattggagaccct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]