ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-16 22:09:04, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_029729867 1578 bp mRNA linear VRT 10-JUL-2025 DEFINITION PREDICTED: Salmo trutta homeobox protein Meis2 (LOC115172431), transcript variant X3, mRNA. ACCESSION XM_029729867 VERSION XM_029729867.1 DBLINK BioProject: PRJNA550988 KEYWORDS RefSeq. SOURCE Salmo trutta (river trout) ORGANISM Salmo trutta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Salmo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_042989.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_901001165.1-RS_2025_07 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.4 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 07/09/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1578 /organism="Salmo trutta" /mol_type="mRNA" /db_xref="taxon:8032" /chromosome="33" gene 1..1578 /gene="LOC115172431" /note="homeobox protein Meis2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 33 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:115172431" CDS 601..1578 /gene="LOC115172431" /codon_start=1 /product="homeobox protein Meis2 isoform X1" /protein_id="XP_029585727.1" /db_xref="GeneID:115172431" /translation="
MAQRYDELAHYGGMDGVGVPASMYGDPHAPRPLPQVHHLNHGPPLHGQHYGAHAPHPSVMPNSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSELGDGLENSVASPGTGDDDDPDKEKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNW"
misc_feature 925..1179
/gene="LOC115172431"
/note="N-terminal of Homeobox Meis and PKNOX1; Region:
Meis_PKNOX_N; pfam16493"
/db_xref="CDD:465140"
misc_feature 1480..>1575
/gene="LOC115172431"
/note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
/db_xref="CDD:428673"
ORIGIN
ctatctagagaggggattggacgagagaaacatacaaaattactttctctacaaaagctttttctttttggaaaagttcattctggactgagaaggggtgcgccatatcgtttaatttgctaaacagccccgttcataattagcagtacgattaaaagtaataataaaacaagatagcaatccggaggcataaagaggacgcggacttgctggatgaaaacgggctgaaaagattcatcctctcttgaacatcatcaccaaccatcattcattcattaccttgacaacccctggctttgattgacagctggagtggcaaaaagccacgagacacgacagtttagttacatgcaggttgttgatgggccgattgtaaccttcagtttggtgcttgacatttttttttattttttggggaaagaggaaaacaagaaaaattgcaaaactcctcctgatgcttctgcttgcactctaccacattggagaataggagaattcgcaaagttggttgaaaaaggaatcttaccactaaatcactttctaacctgactgggatattaaatatacgacacatccaggagtttattggagcgcagcctgatggcgcaaaggtacgatgagctggcccattatggtgggatggacggagtcggggtcccggcgtctatgtacggagacccgcatgctccacggccgctaccccaagtccatcacttgaaccatggaccaccgctccatggccagcactacggtgctcatgcaccccatcccagcgttatgcccaacagcatgggctccgctgtcaacgatgttttaaagagggataaagatcaaatctatggtcacccattattcccgctgctcgcgttggtttttgagaagtgcgagctggcgacgtgcactccgagggagcctggggtagcaggcggcgatgtctgctcctccgactccttcaatgaggacatcgcagtctttgccaaacaggtccgagcagaaaaacctttattttcatcaaatccagagttggacaatttgatgatacaagccatacaagtattacgatttcaccttttggaattagaaaaggtgcacgagctctgcgacaatttttgccaccggtacatcagttgtttgaaaggaaaaatgccaatagatctagttattgacgagcgggatggcagctcgaagtcagaccacgaagagctctcaggatcttcgaccaacctagccgatcacaacccagcttcctggagagaccacgatgacgccacctccacacactcggccggcacgccagggccctccagcgggggccacgcttcacagagcggcgacaacagcagcgaactaggagatggtttagagaacagcgtggcgtctcctggcacaggggatgatgatgatccggacaaggagaagaagaggcagaagaagcgcggcatcttccccaaggtggccaccaacatcatgagggcgtggctgttccagcatctcacgcacccgtacccttctgaagaacagaaaaagcagctagcccaagacacaggcctgaccatcttacaagtaaacaactggtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]