LOCUS       XM_029697683            1966 bp    mRNA    linear   VRT 01-JUL-2019
DEFINITION  PREDICTED: Salmo trutta homeobox protein SIX3-like (LOC115152829),
            mRNA.
ACCESSION   XM_029697683
VERSION     XM_029697683.1
DBLINK      BioProject: PRJNA550988
KEYWORDS    RefSeq.
SOURCE      Salmo trutta (river trout)
  ORGANISM  Salmo trutta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042974.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Salmo trutta Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1966
                     /organism="Salmo trutta"
                     /mol_type="mRNA"
                     /db_xref="taxon:8032"
                     /chromosome="18"
     gene            1..1966
                     /gene="LOC115152829"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 31 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:115152829"
     CDS             227..1108
                     /gene="LOC115152829"
                     /codon_start=1
                     /product="homeobox protein SIX3-like"
                     /protein_id="XP_029553543.1"
                     /db_xref="GeneID:115152829"
                     /translation="

MVFRSPLELYPSHFFLPNFTERPVLLASSTPTRSPEDLSMFALPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEQINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQGIRQNGMRSLSESGCTPRSSAESPSTAASPTTSISSMTERVDTGTSILSVTSSDSECDV"

     misc_feature    368..709
                     /gene="LOC115152829"
                     /note="Transcriptional regulator, SIX1, N-terminal SD
                     domain; Region: SIX1_SD; pfam16878"
                     /db_xref="CDD:435624"
     misc_feature    731..877
                     /gene="LOC115152829"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(734..736,743..745,863..865,872..877)
                     /gene="LOC115152829"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
ORIGIN      

tgattggcacgcttgacagtgattggcagggctgccatgacaacctcacaaccacaccaagaagaccaatagaaaagcgaaacaaaatgtttcagtgctacactcacggtggatttagggggagatattatgaggctggtgtcattaggcaatagctattgaatcgtacaatctttactcgtcttttctttttcttgataactgtatttctctctcaggtcattccatggttttcagatcccctttagagctttatccctcccatttcttcctgccaaacttcactgagcgccctgtgctcttggcgagcagcactcccaccaggtctccagaagacttgtcaatgtttgcgctaccgaccctcaacttctctccggagcaagtggcgagcgtctgtgagacgctggaggaaaccggagacattgaacggctgggacgattcctatggtccctgccggtggcaccgggagcatgcgagcagatcaacaagcatgagtccatcctgcgagctcgcgcagtggttgctttccacaccgggaattttcgagacctttatcacatcttggagaaccacaagtttaccaaagactcccatggcaaactgcaggccatgtggctggaggcacactaccaggaggccgagaagctgcgcggtcgccccttaggaccagttgataagtacagggtacggaagaagttcccactgcccaggaccatctgggatggcgagcagaagacgcactgtttcaaagagaggacgcgcggtctgttaagggagtggtaccttcaggacccatatccaaaccccagcaagaaaagggaactggcacaagccactggactcactcctacacaggtcggaaattggtttaaaaatcggaggcaacgagacagagccgcagcagcaaaaaacaggcttcagcaccagggaattagacagaacggtatgcggtccctttcagaatccgggtgtactccacggagctcggccgaatcgccgtctaccgcggccagtcctactaccagcatctccagtatgacagagcgagttgacactggaacgtccattctttcagtaacatccagtgactccgagtgcgacgtatgatataaaaatataaatatttacaggaaatatggacctgaaaaaaaactatcaaatatcgaggatgaaaaaaggacccatttatataaatatatatataaaaaaaagaacaacaaaaaaacgtattttgtaagcgctttcaatggacccaccacgcccccaccaccaccactacctgcatgatgtttttttgtatctgggaaaaatatcccgttcaatatttctacaaggatcctcgagaagagggaattaattaccagagggtgtttatcgccttttcatctccgttttagtccaagtgatgatgccgctcagtcaagatgcaattctgttttactttatgttcttcagacaatcatttacgttataagcacctttgtactacacttctgtcacttcctgtgtggagtaaatggtgaaatgtggaaccgaatcgttatgactgtatcagatttgtatttttatttcaagattttatattgaattatgtatatgatatctcaaataatgcgctcattctcccggtctgtactatcctatatgtgtagatatgtaaataatgcgatcattctcccggtctgtactatcctatatgtgtacatatgtaaataatgcgatcattctcccggtctgtactatcctatatgtgtacatatgtaaataatgcgatcattctcccggtctgtaatatcctatatgtgtagatatgtaaataatgcgctcgttctcccggtctgtaatatcctatatgtgtagatatgcttgtacataatattgctctcccatctccatcttttctatacttgttcacttttctcgacttggtgttcctacataaaatatttgtcaaaatgtaaaaaa

//