2024-05-20 08:58:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_029648528 926 bp mRNA linear VRT 01-JUL-2019 DEFINITION PREDICTED: Oncorhynchus nerka copper-transporting ATPase 2-like (LOC115119668), partial mRNA. ACCESSION XM_029648528 VERSION XM_029648528.1 DBLINK BioProject: PRJNA548514 KEYWORDS RefSeq. SOURCE Oncorhynchus nerka (sockeye salmon) ORGANISM Oncorhynchus nerka Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_021793892.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Oncorhynchus nerka Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..926 /organism="Oncorhynchus nerka" /mol_type="mRNA" /isolate="On170113-E2" /db_xref="taxon:8023" /chromosome="Unknown" /sex="female" /tissue_type="Caudal fin" /dev_stage="fry" /country="Canada: Pitt Lake, BC" /genotype="Doubled Haploid" gene 1..>926 /gene="LOC115119668" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 53 samples with support for all annotated introns" /db_xref="GeneID:115119668" CDS 132..>926 /gene="LOC115119668" /codon_start=1 /product="copper-transporting ATPase 2-like" /protein_id="XP_029504388.1" /db_xref="GeneID:115119668" /translation="
MAHSSFGSTNTSINGSSGSTKTSINGSSGSTKMATAGEEGKVQKCFIRVTGMTCASCVANIERNLVKHRGVISVLVALMAGKAEVKYDPGIVDAKRITQLIEGLGFGATLIEDNAVMDGKLDLSVTGMTCASCVHNIESKLTRTKGILEASVALATNKAQIKFDPEVLGARDIIRMIEGLGFGASLMKAEGFGNNLDHGEEIQQWKNSFLFSLVFGVPVMGLMIYMMVMDSQHGEHGGSMPEEQNLLPGLSLLNLAFFLLCTPVQ"
misc_feature 270..458 /gene="LOC115119668" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(285..293,300..302) /gene="LOC115119668" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 495..686 /gene="LOC115119668" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(513..521,528..530) /gene="LOC115119668" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 750..>926 /gene="LOC115119668" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
tagtgttccctttatttgtttgagcagtgtatgttgtgttcttttctcctgaataatctggttctgcagaaactccaacaacccctccccttcaaagacaaaagactcccctttccccccactcccccagaatggctcacagtagctttggctctaccaatacttccattaatggtagctctggctctaccaagacttccattaacggtagctctggctctaccaagatggccactgctggtgaggaggggaaggttcagaagtgcttcatccgtgtgacaggcatgacctgtgcgtcctgtgtggccaacattgagaggaacttagtcaaacacagaggtgtcatctcagtgctggttgccctcatggctggtaaggcggaggtgaagtatgaccctggtattgttgatgccaagcggataacacagctcatagagggtctaggcttcggtgccacactgatagaggacaatgctgttatggatgggaaactggacctctctgtaactgggatgacatgtgcgtcatgtgtccataacattgagtccaaactcaccaggaccaaagggattctagaagcctcagttgcactggcaaccaataaagcccagataaagtttgacccagaagtgcttggagctcgtgacatcatcagaatgattgaggggctgggctttggggcgtctctaatgaaagctgaaggctttgggaacaacctggatcatggggaagagattcaacagtggaagaactcgttcctgttcagtctggtgtttggggtgccagtgatgggcttgatgatctacatgatggtgatggacagtcagcacggggaacacggtggctctatgcctgaggagcagaaccttctcccaggcctctccctcctcaacctggccttcttcctgctctgtacacctgtccag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]