2021-01-20 07:24:59, GGRNA.v2 : RefSeq release 203 (Nov, 2020)
LOCUS XM_029032793 300 bp mRNA linear PLN 26-APR-2019 DEFINITION [Candida] auris 60S ribosomal protein L36 (CJI97_000728), partial mRNA. ACCESSION XM_029032793 VERSION XM_029032793.1 DBLINK BioProject: PRJNA535510 BioSample: SAMN05379609 KEYWORDS RefSeq. SOURCE [Candida] auris ORGANISM [Candida] auris Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora; Clavispora/Candida clade. REFERENCE 1 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N. and Cuomo,C.A. TITLE Candida auris genome assembly and annotation JOURNAL Unpublished REFERENCE 2 (bases 1 to 300) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (26-APR-2019) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 300) AUTHORS Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N. and Cuomo,C.A. TITLE Direct Submission JOURNAL Submitted (02-NOV-2017) Genome Sequencing and Analysis Program, Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_021640162). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..300 /organism="[Candida] auris" /mol_type="mRNA" /strain="B11221" /isolation_source="blood" /host="Homo sapiens" /db_xref="taxon:498019" /chromosome="Unknown" /country="South Africa" /collection_date="2012" gene <1..>300 /locus_tag="CJI97_000728" /db_xref="GeneID:40025875" CDS 1..300 /locus_tag="CJI97_000728" /codon_start=1 /transl_table=12 /product="60S ribosomal protein L36" /protein_id="XP_028893108.1" /db_xref="GeneID:40025875" /translation="
MARSGIAVGLNKGHKVNAKEVAPKISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIIAESRRH"
misc_feature 7..279 /locus_tag="CJI97_000728" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:366495" ORIGIN
atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]