LOCUS       XM_029032793             300 bp    mRNA    linear   PLN 26-APR-2019
DEFINITION  [Candida] auris 60S ribosomal protein L36 (CJI97_000728), partial
            mRNA.
ACCESSION   XM_029032793
VERSION     XM_029032793.1
DBLINK      BioProject: PRJNA535510
            BioSample: SAMN05379609
KEYWORDS    RefSeq.
SOURCE      [Candida] auris
  ORGANISM  [Candida] auris
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Metschnikowiaceae; Clavispora;
            Clavispora/Candida clade.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N.
            and Cuomo,C.A.
  TITLE     Candida auris genome assembly and annotation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-APR-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Munoz,J.F., Gade,L.G., Chow,N.A., Litvintseva,A.P., Loparev,V.N.
            and Cuomo,C.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-NOV-2017) Genome Sequencing and Analysis Program,
            Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA
            02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_021640162).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="[Candida] auris"
                     /mol_type="mRNA"
                     /strain="B11221"
                     /isolation_source="blood"
                     /host="Homo sapiens"
                     /db_xref="taxon:498019"
                     /chromosome="Unknown"
                     /country="South Africa"
                     /collection_date="2012"
     gene            <1..>300
                     /locus_tag="CJI97_000728"
                     /db_xref="GeneID:40025875"
     CDS             1..300
                     /locus_tag="CJI97_000728"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_028893108.1"
                     /db_xref="GeneID:40025875"
                     /translation="

MARSGIAVGLNKGHKVNAKEVAPKISQRKGALSQRTKFVRSIVSEVSGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQIIAESRRH"

     misc_feature    7..294
                     /locus_tag="CJI97_000728"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:334407"
ORIGIN      

atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa

//