GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 06:52:13, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_028353631             876 bp    mRNA    linear   PLN 12-MAR-2019
DEFINITION  PREDICTED: Glycine soja ER membrane protein complex subunit 6-like
            (LOC114392481), transcript variant X2, mRNA.
ACCESSION   XM_028353631
VERSION     XM_028353631.1
DBLINK      BioProject: PRJNA525136
KEYWORDS    RefSeq.
SOURCE      Glycine soja
  ORGANISM  Glycine soja
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041018.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Glycine soja Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..876
                     /organism="Glycine soja"
                     /mol_type="mRNA"
                     /cultivar="W05"
                     /db_xref="taxon:3848"
                     /chromosome="17"
                     /tissue_type="hypocotyl of etiolated seedlings"
                     /dev_stage="Seedlings"
                     /country="China: Henan"
     gene            1..876
                     /gene="LOC114392481"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 ESTs, 9 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 109 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:114392481"
     CDS             128..490
                     /gene="LOC114392481"
                     /codon_start=1
                     /product="ER membrane protein complex subunit 6-like"
                     /protein_id="XP_028209432.1"
                     /db_xref="GeneID:114392481"
                     /translation="
MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTFAFDIVHIF"
     misc_feature    230..460
                     /gene="LOC114392481"
                     /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip;
                     pfam07019"
                     /db_xref="CDD:429250"
ORIGIN      
cgaatcacaaatcgtaacattggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctctttttgtggctgtcaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]