LOCUS       XM_028330143             462 bp    mRNA    linear   PLN 12-MAR-2019
DEFINITION  PREDICTED: Glycine soja RING-H2 finger protein ATL43-like
            (LOC114372535), mRNA.
ACCESSION   XM_028330143
VERSION     XM_028330143.1
DBLINK      BioProject: PRJNA525136
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Glycine soja
  ORGANISM  Glycine soja
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041003.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Glycine soja Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..462
                     /organism="Glycine soja"
                     /mol_type="mRNA"
                     /cultivar="W05"
                     /db_xref="taxon:3848"
                     /chromosome="2"
                     /tissue_type="hypocotyl of etiolated seedlings"
                     /dev_stage="Seedlings"
                     /country="China: Henan"
     gene            1..462
                     /gene="LOC114372535"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:114372535"
     CDS             1..462
                     /gene="LOC114372535"
                     /codon_start=1
                     /product="RING-H2 finger protein ATL43-like"
                     /protein_id="XP_028185944.1"
                     /db_xref="GeneID:114372535"
                     /translation="

MVVSFTERKNFGIDWSMVESLPNFKFRVLRGQKEGLNCAVCLNKFKVAKVLRLLSKCKHAFHVECVDSWLDVHSMCPLCCYCMDPEDIFLVEEAKPFHQSHQQQNNDQGRVCLNLDLEKQGIVKSRQRHLFVRGGGRRNNRGVATESEVDDVI"

     misc_feature    112..237
                     /gene="LOC114372535"
                     /note="RING finger (Really Interesting New Gene) domain
                     and U-box domain superfamily; Region: RING_Ubox; cl17238"
                     /db_xref="CDD:450175"
     misc_feature    order(112..114,121..123,169..171,175..177,184..186,
                     193..195,226..228,235..237)
                     /gene="LOC114372535"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:438111"
ORIGIN      

atggtggtgtcgttcaccgaaaggaaaaacttcggcattgactggtctatggtggaatcattaccgaacttcaaattcagagtgctacgggggcaaaaggaaggactcaattgcgcggtgtgcctgaacaagtttaaggtcgcgaaggttctccggctattgtcgaaatgcaagcacgcgtttcacgtggagtgtgtggactcgtggttggacgtgcattctatgtgtcctctctgctgctattgcatggatccagaggacattttcttggtagaggaagcaaagcctttccaccaaagtcatcaacaacagaacaacgatcagggacgcgtgtgtttgaatctggacctggagaagcaggggatagtaaagtctcgacagaggcatttgttcgttcggggtgggggaaggagaaacaacagaggagtagcaacagagtcggaggtggacgacgtcatttag

//