2024-05-20 09:04:32, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_028246180 694 bp mRNA linear PLN 05-MAR-2019 DEFINITION PREDICTED: Camellia sinensis protein ENHANCED DOWNY MILDEW 2-like (LOC114301252), transcript variant X2, mRNA. ACCESSION XM_028246180 VERSION XM_028246180.1 DBLINK BioProject: PRJNA524157 KEYWORDS RefSeq. SOURCE Camellia sinensis ORGANISM Camellia sinensis Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Theaceae; Camellia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_021029725.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Camellia sinensis Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..694 /organism="Camellia sinensis" /mol_type="mRNA" /cultivar="Shuchazao" /db_xref="taxon:4442" /chromosome="Unknown" /tissue_type="young leaf" /country="China: Anhui" gene 1..694 /gene="LOC114301252" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 71 samples with support for all annotated introns" /db_xref="GeneID:114301252" CDS 452..685 /gene="LOC114301252" /codon_start=1 /product="protein ENHANCED DOWNY MILDEW 2-like isoform X2" /protein_id="XP_028101981.1" /db_xref="GeneID:114301252" /translation="
MIVDVLHFYVQDGDMKLDKTGTRCSYKNYDVLQAKNDFNFEDRDWMTVHPKEFPTGSQLVRIMFLLFNMLDLEILGL"
ORIGIN
taaaaaaggttatgatatatctcagtggcaaatgcgcttttcaaagcgtgatatcacctaatgccctttgagtctgaatgagataagtctgttcaacttcacagagacttaaccccatatctattcaaacatttccaaatggttctctctctctctctctctaaaattgttctctttcactagccctaatgagccgtggatgtcaccagcaatgaacttcttggagtttgtagatctacaaagagattgatgtttctaatctcaacagtttcttgtccaatctggatcttgatttcgatttgtgcactaggtcttaggatttgatattttcctttgattcctttcgatttttcgatgtctttatcaatctgggtctttgtttttcatggattcaggtatccaattgctcttgatttggagttgctgagttcacttgagatacatagctttcatgattgttgatgtgcttcatttttatgtacaagatggtgacatgaagcttgataagacggggacgaggtgctcatacaaaaactatgatgttttacaagcaaagaatgacttcaactttgaggacagggattggatgactgtccatccgaaagaatttccaacagggtcacaattggtgagaataatgtttcttttatttaatatgctagatttagaaatcctagggctataaacgatcact
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]