LOCUS       XM_027862744             983 bp    mRNA    linear   MAM 24-JAN-2019
DEFINITION  PREDICTED: Vombatus ursinus yippee like 3 (YPEL3), mRNA.
ACCESSION   XM_027862744
VERSION     XM_027862744.1
DBLINK      BioProject: PRJNA492302
KEYWORDS    RefSeq.
SOURCE      Vombatus ursinus (common wombat)
  ORGANISM  Vombatus ursinus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Metatheria; Diprotodontia; Vombatidae; Vombatus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020954548.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Vombatus ursinus Annotation Release
                                           100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..983
                     /organism="Vombatus ursinus"
                     /mol_type="mRNA"
                     /db_xref="taxon:29139"
                     /chromosome="Unknown"
     gene            1..983
                     /gene="YPEL3"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 19 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:114043667"
     CDS             151..510
                     /gene="YPEL3"
                     /codon_start=1
                     /product="protein yippee-like 3"
                     /protein_id="XP_027718545.1"
                     /db_xref="GeneID:114043667"
                     /translation="

MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCESCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD"

     misc_feature    211..480
                     /gene="YPEL3"
                     /note="C-terminal domain of Retinoic acid-inducible gene
                     (RIG)-I-like Receptors, Cereblon (CRBN), and similar
                     protein domains; Region: RLR_C_like; cl13152"
                     /db_xref="CDD:448830"
ORIGIN      

gggcgtggggacagcgccccggctccggagcgccccaccacctgaccccagaccccggaggaccgggcccctccgcgcacctaggctctgggctccctttgctcaccgtggtcccctccccgggtggggccactgcccccagccccgaccatggttcggatctctaagcccaaaaccttccaagcttatctggatgactgtcaccgaaggtatagctgtgcccactgtcgggcacacctggccaaccatgatgacctcatctccaagtctttccagggtagccagggccgtgcctacctcttcaactctgtggtgaacgtgggttgcgggccagctgaagagcgagtgctactaactgggctccatgctgtggctgatatccactgtgagagctgcaagaccaccctgggctggaaatatgaacaggcctttgagagcagtcagaaatacaaggaggggaagtacatcatcgagctcaaccacatgatcaaggacaatggctgggactgacctctgaccttcaacctcagccccatgattctccctgataagatgattctgctgcccctaccccagccaggctgctggaggaggggcactggtgggagaaacaactacttgcttcctctccagggaccctggggaactgcaagttctccctcctcagggctttgttgggtgatggccccaagcccatgtatatacattttattattttattgcatgcactgtgacttttttgggggggcaggggaagaaatgtccctgttctgctgccccccatgatctggctggtttggatctcatttttaaccctctcccttaccccagattcacctgtagatatgccctttgttgtacataactcctcagcttccttgtcctcctgcctatatacctcaagcctgtgccactctttccccatgatttccttgccccttcgtggtctgtagcatctgtaaataaaactcccggagatacca

//