ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-17 18:56:10, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_027201049 345 bp mRNA linear INV 30-NOV-2018
DEFINITION PREDICTED: Pocillopora damicornis ubiquitin-like protein ATG12
(LOC113683766), mRNA.
ACCESSION XM_027201049
VERSION XM_027201049.1
DBLINK BioProject: PRJNA506040
KEYWORDS RefSeq; includes ab initio.
SOURCE Pocillopora damicornis (cauliflower coral)
ORGANISM Pocillopora damicornis
Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia;
Astrocoeniina; Pocilloporidae; Pocillopora.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_020847271.1) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI
Annotation Status :: Full annotation
Annotation Name :: Pocillopora damicornis Annotation
Release 100
Annotation Version :: 100
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 8.1
Annotation Method :: Best-placed RefSeq; Gnomon
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 17% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..345
/organism="Pocillopora damicornis"
/mol_type="mRNA"
/isolate="RSMAS"
/isolation_source="eastern tropical pacific"
/db_xref="taxon:46731"
/chromosome="Unknown"
/tissue_type="whole animal"
/geo_loc_name="Panama:Saboga Island"
/collection_date="Mar-2005"
/collected_by="PW Glynn"
gene 1..345
/gene="LOC113683766"
/note="Derived by automated computational analysis using
gene prediction method: Gnomon. Supporting evidence
includes similarity to: 1 Protein"
/db_xref="GeneID:113683766"
CDS 1..345
/gene="LOC113683766"
/codon_start=1
/product="ubiquitin-like protein ATG12"
/protein_id="XP_027056850.1"
/db_xref="GeneID:113683766"
/translation="
MADGGGGAVQEEIGRDMVEGQRKMSEPAQPANNHQAQKSEASKKSLKKKVEVLLKAAGDASIMVKKKWVVDGSKQVSYIIEFIRKYIKCEQQDSLCFGADGKLVLHYCKTQAWG"
misc_feature 145..339
/gene="LOC113683766"
/note="ubiquitin-like (Ubl) domain found in
autophagy-related protein 12 (ATG12); Region: Ubl_ATG12;
cd01612"
/db_xref="CDD:340454"
misc_feature order(145..147,151..156,160..162,187..189,193..195,
199..213,220..222,232..237,244..249,253..258,262..264)
/gene="LOC113683766"
/note="Atg12;
Atg5-Atg16-Atg3 interaction site [polypeptide binding];
other site"
/db_xref="CDD:340454"
misc_feature order(163..165,190..192)
/gene="LOC113683766"
/note="key conserved lysines; other site"
/db_xref="CDD:340454"
ORIGIN
atggcggatggtggaggaggagccgtgcaagaagagattggcagagatatggtcgaagggcaacgaaaaatgtctgaaccagcacaacctgcaaacaatcatcaagcacagaaaagcgaagcgtcaaagaaatcattgaaaaagaaagtggaagtgttgcttaaagccgctggagatgcctctattatggtgaaaaagaaatgggtagtggatggatcaaaacaagtgtcatatattatagaatttattaggaagtacatcaaatgcgagcaacaagactcattgtgctttggagctgatggaaagttagttcttcattactgtaagacgcaagcatggggataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]