2024-05-20 09:43:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026833044 252 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Diaphorina citri calcium-transporting ATPase type 2C member 1-like (LOC113473392), partial mRNA. ACCESSION XM_026833044 VERSION XM_026833044.1 DBLINK BioProject: PRJNA251515 KEYWORDS RefSeq. SOURCE Diaphorina citri (Asian citrus psyllid) ORGANISM Diaphorina citri Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Paraneoptera; Hemiptera; Sternorrhyncha; Psylloidea; Psyllidae; Diaphorininae; Diaphorina. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_007405385.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Diaphorina citri Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 3' end. FEATURES Location/Qualifiers source 1..252 /organism="Diaphorina citri" /mol_type="mRNA" /db_xref="taxon:121845" /chromosome="Unknown" /collection_date="2010" gene 1..>252 /gene="LOC113473392" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:113473392" CDS 10..>252 /gene="LOC113473392" /codon_start=1 /product="calcium-transporting ATPase type 2C member 1-like" /protein_id="XP_026688845.1" /db_xref="GeneID:113473392" /translation="
MTEHQLQQVVNSVTVFYRVTPRHKLTIVKAFQANGVIVGMTGDGVNDGVALKKADIGIAMGKQGTDVCKEAADMILVDDDF"
misc_feature <10..>252 /gene="LOC113473392" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
atcgatcaaatgaccgaacatcagctgcaacaggtggtcaactccgtgactgtgttctatcgtgtgactccccgacataaactgactatcgtgaaggcattccaagcgaatggtgtaatagtgggtatgactggggatggcgttaatgacggtgtagcgctgaagaaggcagatattggaatagctatgggcaaacaaggaacggatgtgtgtaaggaagcggctgatatgattctggtggacgatgatttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]