GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:28:59, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_026734104             300 bp    mRNA    linear   PLN 12-OCT-2018
DEFINITION  Candida viswanathii 60S ribosomal protein L36 (RPL36_0), partial
            mRNA.
ACCESSION   XM_026734104
VERSION     XM_026734104.1
DBLINK      BioProject: PRJNA495495
            BioSample: SAMN08818848
KEYWORDS    RefSeq.
SOURCE      Candida viswanathii
  ORGANISM  Candida viswanathii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Candida/Lodderomyces clade; Candida.
REFERENCE   1  (bases 1 to 300)
  AUTHORS   Ahn,J.
  TITLE     Whole genome sequencing of Candida tropicalis (genome annotated by
            CSBL at Korea University)
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 300)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 300)
  AUTHORS   Ahn,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUN-2018) Biotechnology Process Engineering Center,
            KRIBB, 30 Yeongudanji-ro, Ochang-eup Cheongwon-gu, Cheong-joo
            363-883, South Korea
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020797858).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..300
                     /organism="Candida viswanathii"
                     /mol_type="mRNA"
                     /strain="ATCC 20962"
                     /culture_collection="ATCC:20962"
                     /db_xref="taxon:5486"
                     /chromosome="Unknown"
                     /note="POX4, POX5 genes deleted from parent strain ATCC
                     20913"
     gene            <1..>300
                     /gene="RPL36_0"
                     /locus_tag="Cantr_02929"
                     /db_xref="GeneID:38102457"
     CDS             1..300
                     /gene="RPL36_0"
                     /locus_tag="Cantr_02929"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_026597282.1"
                     /db_xref="GeneID:38102457"
                     /db_xref="GO:0003735|GO"
                     /db_xref="GO:0005622|GO"
                     /db_xref="GO:0005840|GO"
                     /db_xref="GO:0006412"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="PFAM:PF01158"
                     /translation="
MAKSGIAVGLNKGRKTTAKEVAPKISYRKGAQSQRAVFVRSIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMNQVIAESRKH"
     misc_feature    7..294
                     /gene="RPL36_0"
                     /locus_tag="Cantr_02929"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:307352"
ORIGIN      
atggctaagtcaggaatcgctgtcggattaaacaaaggtagaaagaccaccgctaaggaagttgctccaaaaatctcatacagaaagggtgctcaatcccaaagagccgttttcgtcagatctatcgtcaaagaagttgccggattggccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaagaaatgaaccaagtcattgctgaatctagaaagcattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]