GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-19 15:01:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_026483119            1092 bp    mRNA    linear   MAM 12-JUN-2023
DEFINITION  PREDICTED: Ursus arctos copper chaperone for superoxide dismutase
            (CCS), transcript variant X2, mRNA.
ACCESSION   XM_026483119
VERSION     XM_026483119.4
DBLINK      BioProject: PRJNA832286
KEYWORDS    RefSeq.
SOURCE      Ursus arctos (brown bear)
  ORGANISM  Ursus arctos
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae;
            Ursus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_026622908) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 12, 2023 this sequence version replaced XM_026483119.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_023065955.2-RS_2023_06
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 06/06/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1092
                     /organism="Ursus arctos"
                     /mol_type="mRNA"
                     /isolate="Adak"
                     /db_xref="taxon:9644"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
                     /ecotype="North America"
     gene            1..1092
                     /gene="CCS"
                     /note="copper chaperone for superoxide dismutase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 18 long SRA reads"
                     /db_xref="GeneID:113244058"
     CDS             325..999
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X2"
                     /protein_id="XP_026338904.1"
                     /db_xref="GeneID:113244058"
                     /translation="
MATDSGDRGTACTLEFTVQMTCQSCVDAVRTSLQGVAGVQSVEVQLENQMVLVQTTLPSEEVQALLEGTGRQAVLKGMGSGLLQNLGAAVAILEGPGPVQGVVRFLQLTPERCLIEGTIDGLEPGPHGLHVHQFGDLTGSCNSCGDHFNPDGASHGGPQDSDRHGMFQTFQSTETCPKLLCPHHPLSTVTNSWPVQLLASPVSSTPPAFLHRYFEADQDIISCN"
     misc_feature    364..>804
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
ORIGIN      
gacagcgggcccagcaaccggtggtaaaagcgctggagctcgggttccggtttatagggctccatctttgcgctgccggcgcgggaggtctgggaaaagcggccaagaggttactaaggcaaccaggggccggagggtccgagtgcgcctgcgcagccagtgccttccaacgcgtggcgtcgggagggcgggcctgacgtgcgcgcgcaccaggaggcggggcaaagtgtggcttccgaagctccgcctccccgcgacgcagttaggggtttgtgcttcaacgctggagcggttcgggtccgaaggctggtgactgggtccgggatggctacggactccggggaccgcgggaccgcctgcacgctggagttcacagtgcagatgacctgtcagagctgcgtggacgcggtgcgcacgtccctgcaaggagtggcaggtgtccagagtgtggaagtgcagttggagaaccagatggtcctggtgcagaccaccctgcccagcgaagaggtgcaggcccttctggaaggcacagggcgacaggcggtgctcaagggcatgggcagtggcctattgcagaatctgggggcagcagttgccattctggagggccctggtcctgtgcaaggggtggtgcgcttcctgcagctgacccctgaacgctgcctcatcgaggggaccattgatggcctggagcctgggcctcatggactccacgtccatcagtttggggacctcacagggagctgcaacagctgtggggaccactttaaccctgatggagcatctcacgggggccctcaggactccgaccggcatggaatgtttcagacattccaaagtacagaaacttgtcccaagctcctgtgtccccatcacccactttcaaccgtgaccaactcttggccagtccaactcttggccagtcctgtttcatctacacctccagcctttctccaccgatattttgaagcagatcaagacatcatttcatgtaactaagcaccgtggggacctggggaacgtccatgctgatgctgatggccgagccagctttaggatagaggatgagcagctgaaggtatggtggaaaag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]