2024-05-19 15:01:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026458019 1166 bp mRNA linear INV 28-SEP-2018 DEFINITION PREDICTED: Hyposmocoma kahamanoa lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog (LOC113225650), mRNA. ACCESSION XM_026458019 VERSION XM_026458019.1 DBLINK BioProject: PRJNA493257 KEYWORDS RefSeq. SOURCE Hyposmocoma kahamanoa ORGANISM Hyposmocoma kahamanoa Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Gelechioidea; Cosmopterigidae; Cosmopteriginae; Hyposmocoma. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020653611.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Hyposmocoma kahamanoa Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1166 /organism="Hyposmocoma kahamanoa" /mol_type="mRNA" /isolate="Upper Pololo Valley" /isolation_source="Oahu" /db_xref="taxon:1477025" /chromosome="Unknown" /tissue_type="whole body" /dev_stage="adult" /country="USA: HI, Oahu" /collection_date="2017" /collected_by="Daniel Rubinoff" /identified_by="Daniel Rubinoff" gene 1..1166 /gene="LOC113225650" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:113225650" CDS 87..467 /gene="LOC113225650" /codon_start=1 /product="lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog" /protein_id="XP_026313804.1" /db_xref="GeneID:113225650" /translation="
MEEKSGNPLPYSGVPTYPHQQLPPDPVNVVPGGVIVQNPIQPNVVSAIVVSPPVGPKPSHMTCQSCGAEIVTRVEYKPSTKTHLIALALCSLGCWCCVCIPYCKDSCQNADHYCPNCDSYIGVYSS"
misc_feature 252..458 /gene="LOC113225650" /note="LITAF-like zinc ribbon domain; Region: zf-LITAF-like; pfam10601" /db_xref="CDD:431386" ORIGIN
accacccatgcgtggtgaccgatagctacgttttaaaaaattaattaaaagagtttcattaagtgttggaaataagtttcatcgaaatggaagaaaaatctgggaatccactgccatactctggagtgccaacgtaccctcaccagcagcttccaccagacccagttaatgtggtccctggtggagtcatcgtccagaaccctatacaaccaaacgtagtttcagccatagtggtcagcccaccggttgggccgaaaccttcccatatgacctgtcagtcttgcggagcagaaattgtaaccagagttgaatataaaccttcaacaaaaactcacctgattgcattagctctttgtagtttgggttgctggtgctgcgtttgcatcccgtattgcaaagattcctgccagaacgccgaccattactgccctaattgtgactcgtatattggagtgtactcttcctagattgtcataatttcgagaagtattttgcactctacctatctatggctttttgggatcaaattttgttagtgtaagcgtcagcgcaaagcggtggctggcaattcagaggacattaaattcttcaatgcatattctatgcaatttcaattaattgaaataatgacctgagaccggcttcagagcatcgtggcgcatttgtctttgcggtattgaagagcacgctagacgatatcgatatgcaacggaatccaccggttttgcacctagatgcgctgcgcttcactgcgtagttgctagtgaaacaaattgtaatccatttgtaatccaagcgaccgatgggatgtcggcggatgccgcagaatcgtaaaggatcctcatttcattccggtttgcgttggcctttaaagatatgtcatttatggtccctaaattagaacgcttgtattgctattaaagtcaatatcgaacccttaaaaaccattcgatgttttggaatatgacatatagctgctagaaaaagtttgtcaccgttgtgtatttttgttgagtacatatttctagtacatttatgacgagaataattcgcgaaagaaaatatgcgaggatcgtaagtggtgatcaaagtgtgggtataactacacgtacaagggactagtcaactgtatgtcttagagcgacaggtgcagtgacagtgcacct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]