2024-05-20 08:27:52, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_026160838 1053 bp mRNA linear VRT 04-SEP-2018 DEFINITION PREDICTED: Astatotilapia calliptera copper-transporting ATPase 2-like (LOC113017725), transcript variant X5, mRNA. ACCESSION XM_026160838 VERSION XM_026160838.1 DBLINK BioProject: PRJNA488811 KEYWORDS RefSeq. SOURCE Astatotilapia calliptera (eastern happy) ORGANISM Astatotilapia calliptera Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Ovalentaria; Cichlomorphae; Cichliformes; Cichlidae; African cichlids; Pseudocrenilabrinae; Haplochromini; Astatotilapia. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_020535728.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Astatotilapia calliptera Annotation Release 100 Annotation Version :: 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1053 /organism="Astatotilapia calliptera" /mol_type="mRNA" /db_xref="taxon:8154" /chromosome="Unknown" gene 1..1053 /gene="LOC113017725" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:113017725" CDS 55..999 /gene="LOC113017725" /codon_start=1 /product="copper-transporting ATPase 2-like isoform X2" /protein_id="XP_026016623.1" /db_xref="GeneID:113017725" /translation="
MMQENDHDIEKQGFENLAYEYGSQTELCPPPKAASRASFKLQRITSEHEVHIIQTRICSLNGIIAVTWSVPNSLAKVDYDASVIPTKEIALELQTLGYSVESVVQIRVDEPIKSVQSHEKSQPVSFGLSDMSTNRPVVSNGTGSQAPSASSPEIKAQKCFICVTGMTCASCVSNIERNLLKHRGIFSVLVSLMAGKAEVKYDSHVLDATAVTELIKDLGFGAKVIEDNAVAHGKLDLTITGMTCASCVHNIESKLNLTRGILMASVALATNKAQVEFDPEVLGPRDIIKLIQGLGFEARLATWQRPQQTMWKST"
misc_feature 541..723 /gene="LOC113017725" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(550..558,565..567) /gene="LOC113017725" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" misc_feature 760..951 /gene="LOC113017725" /note="Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones. HMA domain...; Region: HMA; cd00371" /db_xref="CDD:238219" misc_feature order(778..786,793..795) /gene="LOC113017725" /note="metal-binding site [ion binding]" /db_xref="CDD:238219" ORIGIN
cacctgaaagaacatatttacataacatgcagttacggcgtgacgcaggtgctcatgatgcaggagaatgaccatgacattgagaaacaaggctttgaaaacctggcctacgagtatgggagccaaactgagctctgccctccacctaaagctgcctcaagagcatcttttaaacttcagcggatcacctctgagcatgaggtccacatcatccaaaccagaatctgcagcctgaatggaataattgctgtcacatggtctgtacccaacagtttggccaaggtggactatgatgcttcagttattccaaccaaagagatcgccctggaactacagaccttgggatacagcgtggagtctgtggtgcagatcagggtggatgaacctataaagagtgttcagagtcatgaaaagtcccagcctgtaagctttggactttctgacatgtcaacaaacaggcctgtagtcagcaatgggacgggttcacaggcaccatctgcaagttcgcctgagataaaagcacagaaatgcttcatctgcgttacggggatgacctgtgcctcctgtgtgtccaacatcgagaggaacctgctcaaacacagaggaatcttctcagtgttggtgtcgctaatggccggtaaggcagaggtgaagtatgattcacatgtcctggatgctactgcagtgactgagctcatcaaagacttgggctttggtgccaaagtgattgaggataatgcagtagcacatggaaagctggacctcactataacaggcatgacgtgcgcatcatgtgtccacaacatcgagtccaagctcaacttaaccagagggatcctcatggcttcggtcgcactggcaaccaacaaagctcaggttgagtttgacccagaggtgctcggacctcgggatattatcaagctcatccagggtcttggatttgaggccaggctggctacatggcagcgtccccagcaaaccatgtggaagtcaacctgaccgcgtagctactcatgcagcaagaggcaacagatggatgagggaaggggaggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]