GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 07:08:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_025927421             258 bp    mRNA    linear   MAM 26-JUL-2018
DEFINITION  PREDICTED: Puma concolor chromosome unknown C2orf70 homolog
            (CUNH2orf70), mRNA.
ACCESSION   XM_025927421
VERSION     XM_025927421.1
DBLINK      BioProject: PRJNA481988
KEYWORDS    RefSeq.
SOURCE      Puma concolor (puma)
  ORGANISM  Puma concolor
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;
            Felinae; Puma.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_020339628.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Puma concolor Annotation Release 100
            Annotation Version          :: 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..258
                     /organism="Puma concolor"
                     /mol_type="mRNA"
                     /isolate="SC36_Marlon"
                     /db_xref="taxon:9696"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
                     /dev_stage="adult"
     gene            1..258
                     /gene="CUNH2orf70"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:112864348"
     CDS             1..258
                     /gene="CUNH2orf70"
                     /codon_start=1
                     /product="UPF0573 protein C2orf70 homolog"
                     /protein_id="XP_025783206.1"
                     /db_xref="GeneID:112864348"
                     /translation="
MAQQHRKYYLDKTGTVPQVPYFVLPVKEWERYPLPTDLPPLSPEKKWHLLRVSPENLKTYQRFPSGKRVTPHERQRRDCYFEFRA"
ORIGIN      
atggcgcagcagcataggaagtactatctagacaagacgggcacggtgccccaggtgccctacttcgtgctgcctgtgaaggagtgggaacgataccccctccccaccgaccttcctcctctgagcccagagaagaagtggcaccttttaagagtatctcccgagaacttgaagacctaccagaggttcccctcggggaagagggtcaccccccacgagcggcagaggagagactgctactttgagttcagagcgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]