GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 09:04:18, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_025841765             422 bp    mRNA    linear   PLN 24-MAY-2019
DEFINITION  PREDICTED: Arachis hypogaea uncharacterized LOC112799733
            (LOC112799733), mRNA.
ACCESSION   XM_025841765
VERSION     XM_025841765.2
DBLINK      BioProject: PRJNA476953
KEYWORDS    RefSeq.
SOURCE      Arachis hypogaea (peanut)
  ORGANISM  Arachis hypogaea
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; dalbergioids sensu lato; Dalbergieae;
            Pterocarpus clade; Arachis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_037622.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 24, 2019 this sequence version replaced XM_025841765.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Arachis hypogaea Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..422
                     /organism="Arachis hypogaea"
                     /mol_type="mRNA"
                     /cultivar="Tifrunner"
                     /db_xref="taxon:3818"
                     /chromosome="Arahy.05"
                     /tissue_type="etiolated young seedling"
                     /dev_stage="seedling"
                     /country="USA: Georgia"
     gene            1..422
                     /gene="LOC112799733"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 20 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:112799733"
     CDS             96..410
                     /gene="LOC112799733"
                     /codon_start=1
                     /product="uncharacterized protein LOC112799733"
                     /protein_id="XP_025697550.2"
                     /db_xref="GeneID:112799733"
                     /translation="
MRPSAGSSFDALEKSNINMGTTPPSIVAMRVLPMEMNDVCTFEADIEYSGGAVVEIETRLEVGEPQNDKGTECSSNAGAAPSDLEDLNNQLNLGDGVNDSQEPK"
     misc_feature    <138..>275
                     /gene="LOC112799733"
                     /note="synaptotagmin-like mitochondrial-lipid-binding
                     protein (SMP) domain superfamily; Region: SMP_SF; cl45903"
                     /db_xref="CDD:459248"
ORIGIN      
gcgctcagagtgaaaaacttaagtggtctagtcagttgtacgaagagtgtcatcgatatctagcatcactaaatattgaatatcatccttttatcatgagaccatcagcaggatcaagttttgatgccttagaaaagtccaacatcaatatggggactactccaccctctatcgttgcaatgagggttcttcctatggaaatgaatgatgtatgcacctttgaggcagacattgaatattctggaggtgcagtagttgagattgaaacaaggcttgaagttggtgaaccacagaacgataaggggacggaatgctcaagcaatgctggggctgccccatcagatcttgaagatcttaacaatcagttgaatcttggagacggagtgaatgattcacaagagccaaagtagatgtcaatggga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]