LOCUS       XM_025787208             665 bp    mRNA    linear   PLN 24-MAY-2019
DEFINITION  PREDICTED: Arachis hypogaea heavy metal-associated isoprenylated
            plant protein 33 (LOC112737348), mRNA.
ACCESSION   XM_025787208
VERSION     XM_025787208.2
DBLINK      BioProject: PRJNA476953
KEYWORDS    RefSeq.
SOURCE      Arachis hypogaea (peanut)
  ORGANISM  Arachis hypogaea
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; dalbergioids sensu lato; Dalbergieae;
            Pterocarpus clade; Arachis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_037630.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 24, 2019 this sequence version replaced XM_025787208.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Arachis hypogaea Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Arachis hypogaea"
                     /mol_type="mRNA"
                     /cultivar="Tifrunner"
                     /db_xref="taxon:3818"
                     /chromosome="Arahy.13"
                     /tissue_type="etiolated young seedling"
                     /dev_stage="seedling"
                     /country="USA: Georgia"
     gene            1..665
                     /gene="LOC112737348"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 60 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:112737348"
     CDS             314..553
                     /gene="LOC112737348"
                     /codon_start=1
                     /product="heavy metal-associated isoprenylated plant
                     protein 33"
                     /protein_id="XP_025642993.1"
                     /db_xref="GeneID:112737348"
                     /translation="

MLEHSRLKTMKKDFIDDEVDHVFDLNFAFALFKDFIDDEVDHVFDEDDEDYDDDRFDNDIDTPPPPNKMKQPPSPMMVN"

ORIGIN      

gttctgtctagctttttcatctctgaatatgattgtttgttgggaggatggtggtgctaaggagaaggaggtgacgacggttggctacgacgccgtcggtttctctgaactattgaaagaaatgcagaacactatggatccgacataagaggagcaacagcgacggagaggagctagcttgcaacaaagaggagcgacggcggggtgcgagcttgcgacagagaggagaggggaggcgcgacgacgccgaggcgccggagatggatgaagggcaggaagagaaagagtagatgcggtagtttgattgttgttaatgttagagcattcaaggttaaagacgatgaaaaaggatttcatcgatgacgaagtagaccatgtgtttgatctcaactttgcctttgctcttttcaaggatttcatcgatgacgaagtagaccatgtgtttgatgaggatgatgaggactatgacgacgatagatttgacaatgacatagacacgcctcctcctcccaacaagatgaagcagcccccaagccccatgatggtgaactgaatgggaaccatccacagttcacaaatgctcccaagggtgggggtggtggcagtggtagtgaaggaggtaacgaaaagcaaggcagtggcagtggtggtgggccagccggctg

//