2024-05-20 08:27:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_025770109 651 bp mRNA linear PLN 24-MAY-2019 DEFINITION PREDICTED: Arachis hypogaea copper-transporting ATPase PAA1, chloroplastic-like (LOC112718319), mRNA. ACCESSION XM_025770109 VERSION XM_025770109.2 DBLINK BioProject: PRJNA476953 KEYWORDS RefSeq. SOURCE Arachis hypogaea (peanut) ORGANISM Arachis hypogaea Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; dalbergioids sensu lato; Dalbergieae; Pterocarpus clade; Arachis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_037627.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 24, 2019 this sequence version replaced XM_025770109.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Arachis hypogaea Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.2 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..651 /organism="Arachis hypogaea" /mol_type="mRNA" /cultivar="Tifrunner" /db_xref="taxon:3818" /chromosome="Arahy.10" /tissue_type="etiolated young seedling" /dev_stage="seedling" /country="USA: Georgia" gene 1..651 /gene="LOC112718319" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 48 samples with support for all annotated introns" /db_xref="GeneID:112718319" CDS 79..486 /gene="LOC112718319" /codon_start=1 /product="copper-transporting ATPase PAA1, chloroplastic-like" /protein_id="XP_025625894.1" /db_xref="GeneID:112718319" /translation="
MVGDGVNDAAALASSHIGIALGGGVGAASEVSSIVLMCNQLSQLVDALELSRLTMNTVKQNLWWAFIYNIVGIPIAAGVLFPINGTMLTPSIAGALMGLSSIGVKTNSLLFKIQIFCKAETNTWYVAEDQNLCRF"
misc_feature <79..414 /gene="LOC112718319" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
caggttctatctggagtgaaatcagatgggaaaaagaagttcataaatgaactacagaaagatcagaagattgtagctatggttggtgatggagttaatgatgcagctgccctggcttcttcacatattggtatcgcattaggtggaggtgttggagctgctagtgaggtgtcttctattgtattgatgtgcaaccagctctcacagttagttgatgctttggagctcagcaggctaaccatgaatactgtaaaacaaaatctttggtgggccttcatatacaacattgtagggattccaattgctgctggagtgttattccctataaatggaaccatgctgactccatcaattgctggggctctcatggggttgagttccatcggtgtaaagaccaactcgttactttttaagattcagattttctgcaaagcagaaacaaatacatggtatgttgccgaagaccaaaatctatgcagattctgacctggaaaatcaaaatcagaaactgaaataccggtattagatgttaggaggctcctcctaatagcatagaaacgaggttccccatcctgatgtcaggattactgcataatgccggctttgcatggggatattaggtgaggcatcatccttaagctaccgttataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]