2024-05-18 14:18:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_025601064 402 bp mRNA linear PLN 08-MAR-2021 DEFINITION Aspergillus niger CBS 101883 uncharacterized protein (BO96DRAFT_436136), partial mRNA. ACCESSION XM_025601064 VERSION XM_025601064.1 DBLINK BioProject: PRJNA479910 BioSample: SAMN05660348 KEYWORDS RefSeq. SOURCE Aspergillus niger CBS 101883 (Aspergillus lacticoffeatus CBS 101883) ORGANISM Aspergillus niger CBS 101883 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus subgen. Circumdati. REFERENCE 1 (bases 1 to 402) AUTHORS Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C., Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A., Henrissat,B., Wiebenga,A., De Vries,R.P., Grigoriev,I.V., Mortensen,U.H., Andersen,M.R. and Baker,S.E. CONSRTM DOE Joint Genome Institute TITLE The genomes of Aspergillus section Nigri reveals drivers in fungal speciation JOURNAL Unpublished REFERENCE 2 (bases 1 to 402) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (05-MAR-2021) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 402) AUTHORS Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A., Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C., Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Henrissat,B., Wiebenga,A., De Vries,R.P., Mortensen,U.H., Andersen,M.R., Baker,S.E., Grigoriev,I.V., Nordberg,H.P., Cantor,M.N. and Hua,S.X. CONSRTM DOE Joint Genome Institute TITLE Direct Submission JOURNAL Submitted (15-DEC-2016) DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_020290904). ##Metadata-START## Organism Display Name :: Aspergillus lacticoffeatus CBS 101883 v1.0 GOLD Stamp ID :: Gp0047282 ##Metadata-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..402 /organism="Aspergillus niger CBS 101883" /mol_type="mRNA" /strain="CBS 101883" /culture_collection="CBS:101883" /type_material="culture from holotype of Aspergillus lacticoffeatus" /db_xref="taxon:1450533" /chromosome="Unknown" gene <1..>402 /locus_tag="BO96DRAFT_436136" /db_xref="GeneID:37102929" CDS 1..402 /locus_tag="BO96DRAFT_436136" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_025452571.1" /db_xref="GeneID:37102929" /db_xref="JGIDB:Asplac1_436136" /translation="
MTNTISAWVVLPRHAELYPKREGLATPDWVALSQKASERAIAEPSAAVNADHPGVPSAARVLPIALRRNQLKKATLPHSQSGMSDCNTTPGECEPRLHHYHAHKSHSLFVRYCIPCTDLVYHLILSAARVRFL"
ORIGIN
atgacgaacacaatcagtgcgtgggttgttttgcccaggcacgcggagttgtatcccaagagagaaggtctggccactcctgattgggttgccttgagccagaaggcgtccgagcgagcgatagcagaaccttcagctgcggtcaacgccgatcaccctggtgtcccgtcggctgccagagttttgccgatcgcgctgcgcagaaatcagttgaaaaaagcaactcttccccacagtcaatctgggatgagcgactgcaataccactccgggggagtgtgagccgaggctgcatcattaccatgctcataagtctcattctttgttcgttcggtattgcatcccttgcaccgacctggtgtaccatctgattttgagtgcagcaagggtaaggttcttatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]