GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-18 14:18:55, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_025601064             402 bp    mRNA    linear   PLN 08-MAR-2021
DEFINITION  Aspergillus niger CBS 101883 uncharacterized protein
            (BO96DRAFT_436136), partial mRNA.
ACCESSION   XM_025601064
VERSION     XM_025601064.1
DBLINK      BioProject: PRJNA479910
            BioSample: SAMN05660348
KEYWORDS    RefSeq.
SOURCE      Aspergillus niger CBS 101883 (Aspergillus lacticoffeatus CBS
            101883)
  ORGANISM  Aspergillus niger CBS 101883
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
            Aspergillus; Aspergillus subgen. Circumdati.
REFERENCE   1  (bases 1 to 402)
  AUTHORS   Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C.,
            Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Kuo,A., Riley,R., Clum,A.,
            Nolan,M., Lipzen,A., Salamov,A., Henrissat,B., Wiebenga,A., De
            Vries,R.P., Grigoriev,I.V., Mortensen,U.H., Andersen,M.R. and
            Baker,S.E.
  CONSRTM   DOE Joint Genome Institute
  TITLE     The genomes of Aspergillus section Nigri reveals drivers in fungal
            speciation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 402)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAR-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 402)
  AUTHORS   Kuo,A., Riley,R., Clum,A., Nolan,M., Lipzen,A., Salamov,A.,
            Vesth,T.C., Nybo,J., Theobald,S., Brandl,J., Frisvad,J.C.,
            Nielsen,K.F., Lyhne,E.K., Kogle,M.E., Henrissat,B., Wiebenga,A., De
            Vries,R.P., Mortensen,U.H., Andersen,M.R., Baker,S.E.,
            Grigoriev,I.V., Nordberg,H.P., Cantor,M.N. and Hua,S.X.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2016) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_020290904).
            
            ##Metadata-START##
            Organism Display Name :: Aspergillus lacticoffeatus CBS 101883 v1.0
            GOLD Stamp ID         :: Gp0047282
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..402
                     /organism="Aspergillus niger CBS 101883"
                     /mol_type="mRNA"
                     /strain="CBS 101883"
                     /culture_collection="CBS:101883"
                     /type_material="culture from holotype of Aspergillus
                     lacticoffeatus"
                     /db_xref="taxon:1450533"
                     /chromosome="Unknown"
     gene            <1..>402
                     /locus_tag="BO96DRAFT_436136"
                     /db_xref="GeneID:37102929"
     CDS             1..402
                     /locus_tag="BO96DRAFT_436136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_025452571.1"
                     /db_xref="GeneID:37102929"
                     /db_xref="JGIDB:Asplac1_436136"
                     /translation="
MTNTISAWVVLPRHAELYPKREGLATPDWVALSQKASERAIAEPSAAVNADHPGVPSAARVLPIALRRNQLKKATLPHSQSGMSDCNTTPGECEPRLHHYHAHKSHSLFVRYCIPCTDLVYHLILSAARVRFL"
ORIGIN      
atgacgaacacaatcagtgcgtgggttgttttgcccaggcacgcggagttgtatcccaagagagaaggtctggccactcctgattgggttgccttgagccagaaggcgtccgagcgagcgatagcagaaccttcagctgcggtcaacgccgatcaccctggtgtcccgtcggctgccagagttttgccgatcgcgctgcgcagaaatcagttgaaaaaagcaactcttccccacagtcaatctgggatgagcgactgcaataccactccgggggagtgtgagccgaggctgcatcattaccatgctcataagtctcattctttgttcgttcggtattgcatcccttgcaccgacctggtgtaccatctgattttgagtgcagcaagggtaaggttcttatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]